{ "metadata" : { "version" : 1, "result" : 1, "reason" : "OK", "command" : "listaccts" }, "data" : { "acct" : [ { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 949, "max_email_per_hour" : "*unknown*", "owner" : "topweblogic", "suspendtime" : 0, "unix_startdate" : 1710327434, "child_nodes" : [], "startdate" : "24 Mar 13 16:27", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "68M", "suspendreason" : "not suspended", "domain" : "prashniindustries.in", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "default", "user" : "prashniindustrie", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "uid" : "2136", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter" }, { "child_nodes" : [], "startdate" : "25 Jun 02 14:14", "unix_startdate" : 1748853883, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "max_email_per_hour" : "25", "inodesused" : 44662, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "user" : "maasaraswati", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2322", "maxsql" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.254.16.113", "domain" : "maasaraswatiaducationtrust.in", "suspendreason" : "not suspended", "diskused" : "917M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1" }, { "suspendreason" : "not suspended", "diskused" : "35M", "ip" : "51.91.152.238", "domain" : "kdchedu.org", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "kdchedu", "plan" : "websbook_linux_500mb", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1191", "maxsql" : "1", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 547, "owner" : "websbook", "suspendtime" : 0, "startdate" : "18 Feb 12 17:12", "child_nodes" : [], "unix_startdate" : 1518435738, "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0" }, { "inodesused" : 1022, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "child_nodes" : [], "startdate" : "17 Mar 24 18:47", "unix_startdate" : 1490361446, "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "200M", "domain" : "bhsdegreecollege.org.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "30M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "babudegree", "plan" : "websbook_Linux_100mb", "outgoing_mail_suspended" : 0, "backup" : 1, "max_emailacct_quota" : "unlimited", "maxftp" : "0", "uid" : "1100", "maxsql" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited" }, { "child_nodes" : [], "startdate" : "23 Feb 07 17:43", "unix_startdate" : 1675771985, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home", "email" : "salin1608official@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 74314, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "root", "user" : "alphach1", "plan" : "Red14Backup", "outgoing_mail_suspended" : 0, "backup" : 1, "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1003", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "10", "domain" : "alphacharitabletrust.org", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "19290M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "unlimited", "maxaddons" : "unlimited" }, { "diskused" : "454M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "iconicdesignstudio.co.in", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "iconicdesign", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2281", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 10354, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1731571873, "child_nodes" : [], "startdate" : "24 Nov 14 13:41", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited" }, { "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 64937, "max_email_per_hour" : "25", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1766753008, "child_nodes" : [], "startdate" : "25 Dec 26 18:13", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "957M", "suspendreason" : "not suspended", "domain" : "vanshmanigaushala.in", "ip" : "51.254.16.113", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2719", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "vanshmanigaushal" }, { "child_nodes" : [], "startdate" : "14 Aug 06 20:19", "unix_startdate" : 1407336576, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "max_email_per_hour" : "25", "inodesused" : 640, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "user" : "spmdcs", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "1310", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "spmdcs.in", "suspendreason" : "not suspended", "diskused" : "26M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0" }, { "email" : "togolais2008@gmail.com", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "100000M", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1681199922, "child_nodes" : [], "startdate" : "23 Apr 11 13:28", "owner" : "otiyahos", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 42322, "max_email_per_hour" : "25", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "uid" : "1037", "maxsql" : "20", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "otiyahos_ECO", "user" : "rcjfm", "maxparked" : "0", "maxaddons" : "10", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "2879M", "suspendreason" : "not suspended", "domain" : "rcjfm.tg", "ip" : "51.91.152.238" }, { "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "child_nodes" : [], "startdate" : "17 Jul 23 09:14", "unix_startdate" : 1500781453, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 654, "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "1283", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "sgpvtiti", "plan" : "websbook_linux_500mb", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "25M", "ip" : "51.91.152.238", "domain" : "sgpvtiti.org" }, { "plan" : "otiyahos_ECO", "user" : "paradisfm", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1034", "maxsql" : "20", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "ip" : "51.91.152.238", "domain" : "paradisfm.org", "diskused" : "2086M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "10", "maxparked" : "0", "unix_startdate" : 1695894101, "startdate" : "23 Sep 28 15:11", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "100000M", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home", "email" : "agenceotiya@gmail.com", "maxlst" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 38460, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "otiyahos" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 69376, "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "26 Apr 08 18:04", "child_nodes" : [], "unix_startdate" : 1775651676, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "suspendreason" : "not suspended", "diskused" : "932M", "ip" : "51.254.16.113", "domain" : "krutikaeducationwelfare.co.in", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "krutikaeducation", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2844" }, { "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxsql" : "1", "uid" : "1128", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "collvdlaworg", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "109M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "vdlawcollege.org.in", "disklimit" : "500M", "has_backup" : 0, "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "unix_startdate" : 1746039411, "startdate" : "25 May 01 00:26", "child_nodes" : [], "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 2017 }, { "ip" : "51.254.16.113", "domain" : "vishwajyotismgsk.org.in", "suspendreason" : "not suspended", "diskused" : "941M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "user" : "vishwajyotismgsk", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2498", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 45312, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "25 Aug 01 11:42", "child_nodes" : [], "unix_startdate" : 1754028728, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2" }, { "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "uid" : "1985", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "apkquest_1gb", "user" : "sjsshan2", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "608M", "suspendreason" : "not suspended", "domain" : "sjsshankergarh.com", "ip" : "51.91.152.238", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "maxlst" : "unlimited", "disklimit" : "1024M", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1757067910, "child_nodes" : [], "startdate" : "25 Sep 05 15:55", "owner" : "apkquest", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 13038, "max_email_per_hour" : "25" }, { "unix_startdate" : 1753351910, "child_nodes" : [], "startdate" : "25 Jul 24 15:41", "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 57299, "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "cowlogyinstitute", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2219", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "diskused" : "880M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "cowlogyinstitute.org", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "arzookiranfounda", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2703", "suspendreason" : "not suspended", "diskused" : "1230M", "ip" : "51.254.16.113", "domain" : "arzookiranfoundation.org", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "startdate" : "25 Dec 13 15:09", "child_nodes" : [], "unix_startdate" : 1765618780, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 66946, "owner" : "winggolearning", "suspendtime" : 0 }, { "domain" : "englishhub.in", "ip" : "51.91.152.238", "diskused" : "142M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "plan" : "websbook_linux_500mb", "user" : "englishhub", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "1148", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "inodesused" : 4094, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1460319036, "startdate" : "16 Apr 11 01:40", "child_nodes" : [], "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M" }, { "child_nodes" : [], "startdate" : "24 May 09 13:48", "unix_startdate" : 1715242706, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "email" : "onedestinyahead@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 130, "owner" : "pawsnmei", "suspendtime" : 1767126021, "backup" : 1, "outgoing_mail_suspended" : 1, "user" : "revankaradmin", "plan" : "default", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1522", "maxsql" : "unlimited", "suspendreason" : "Unknown", "diskused" : "4M", "ip" : "51.91.152.238", "domain" : "revankarhospital.com", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0 }, { "plan" : "otiyahos_ECO", "user" : "fenucoopeto", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxsql" : "20", "uid" : "1019", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "ip" : "51.91.152.238", "domain" : "fenucoopeto.tg", "diskused" : "727M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "10", "maxparked" : "0", "unix_startdate" : 1664280695, "startdate" : "22 Sep 27 17:41", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "100000M", "has_backup" : 0, "email" : "togolais2008@gmail.com", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 20337, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "otiyahos" }, { "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 67369, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "25 Dec 05 12:51", "unix_startdate" : 1764919302, "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1170M", "ip" : "51.254.16.113", "domain" : "wwfo.org", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2681", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "wwfo", "plan" : "winggolearning_raj" }, { "inodesused" : 14107, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "thesunda", "unix_startdate" : 1724679884, "child_nodes" : [], "startdate" : "24 Aug 26 19:14", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "sacretcode@gmail.com", "maxlst" : "0", "has_backup" : 0, "disklimit" : "1024M", "domain" : "konnectawards.com", "ip" : "51.91.152.238", "diskused" : "650M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "plan" : "thesunda_cine1024", "user" : "konnectawards", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "1415", "maxsql" : "5", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "3", "ipv6" : [], "max_defer_fail_percentage" : "unlimited" }, { "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2599", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "hhtechsolution_H_Basic", "user" : "bvninternational", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "463M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "bvninternationalsaf.com", "disklimit" : "250M", "has_backup" : 0, "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "unix_startdate" : 1715699384, "startdate" : "24 May 14 20:39", "child_nodes" : [], "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 9 }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 18025, "owner" : "root", "suspendtime" : 1762151431, "startdate" : "24 Jul 03 16:02", "child_nodes" : [], "unix_startdate" : 1720002734, "disklimit" : "10000M", "has_backup" : 0, "maxlst" : "unlimited", "email" : "aparna@tll.co.in", "partition" : "home2", "outgoing_mail_hold" : 0, "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "suspendreason" : "Overdue on Payment", "diskused" : "1673M", "ip" : "51.91.152.238", "domain" : "timeslogistics.group", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 1, "user" : "timeslog", "plan" : "Red91Solid", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1518", "maxsql" : "unlimited" }, { "diskused" : "1216M", "suspendreason" : "not suspended", "domain" : "amplitechfoundation.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "amplitechfoundat", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "unlimited", "uid" : "2736", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 66671, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1767787517, "startdate" : "26 Jan 07 17:35", "child_nodes" : [], "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 899, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0, "startdate" : "17 Oct 17 11:03", "child_nodes" : [], "unix_startdate" : 1508218386, "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "30M", "domain" : "brmemorialpublicschool.org", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "brmemorialpublic", "plan" : "websbook_linux_500mb", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1115", "maxsql" : "1", "theme" : "jupiter" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "100", "inodesused" : 142926, "owner" : "root", "suspendtime" : 1752215426, "startdate" : "21 Jul 11 10:20", "child_nodes" : [], "unix_startdate" : 1625979020, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home", "email" : "tanmay361984@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "suspendreason" : "Overdue on Payment", "diskused" : "5387M", "ip" : "51.91.152.238", "domain" : "asianprimetime.com", "maxparked" : "unlimited", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 1, "user" : "asianpri", "plan" : "Red12Backup", "ipv6" : [], "max_defer_fail_percentage" : "10", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1005" }, { "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "startdate" : "25 Sep 17 16:42", "child_nodes" : [], "unix_startdate" : 1758107521, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 34900, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2376", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "platileaf", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "platinumleaf.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "581M" }, { "plan" : "royaldiagnosticc_Unlimited", "user" : "arogya", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "1983", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "domain" : "arogya.in", "ip" : "51.91.152.238", "diskused" : "602M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "unix_startdate" : 1755506799, "startdate" : "25 Aug 18 14:16", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 32287, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "royaldiagnosticc" }, { "suspendreason" : "not suspended", "diskused" : "963M", "domain" : "athswf.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "athswf", "plan" : "winggolearning_raj", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2191", "theme" : "jupiter", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 35843, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "24 Oct 23 12:28", "child_nodes" : [], "unix_startdate" : 1729666721, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited" }, { "has_backup" : 0, "disklimit" : "200M", "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "child_nodes" : [], "startdate" : "13 Mar 01 13:50", "unix_startdate" : 1362126001, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 637, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "maxsql" : "1", "uid" : "1337", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "vishwana", "plan" : "websbook_Linux_100mb", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "18M", "ip" : "51.91.152.238", "domain" : "vishwanathmahavidyalaya.org" }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "pdpiti.in", "suspendreason" : "not suspended", "diskused" : "13M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1232", "maxsql" : "1", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "user" : "pdpiti", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 399, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "startdate" : "17 Jul 07 15:25", "child_nodes" : [], "unix_startdate" : 1499421315 }, { "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2527", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "shrilainababasoc", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "932M", "suspendreason" : "not suspended", "domain" : "shrilainababasociety.in", "ip" : "51.254.16.113", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1760104618, "startdate" : "25 Oct 10 19:26", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 42674, "max_email_per_hour" : "25" }, { "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1523M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "codexdrugs.in", "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "legacy_backup" : 0, "maxpop" : "5", "theme" : "jupiter", "maxsql" : "5", "uid" : "2727", "max_emailacct_quota" : "unlimited", "maxftp" : "2", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "default", "user" : "drugcodex", "owner" : "topweblogic", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 39984, "has_backup" : 0, "disklimit" : "5000M", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "25", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "unix_startdate" : 1767171592, "child_nodes" : [], "startdate" : "25 Dec 31 14:29" }, { "max_email_per_hour" : "*unknown*", "inodesused" : 38277, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "topweblogic", "startdate" : "23 Aug 26 13:38", "child_nodes" : [], "unix_startdate" : 1693037339, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "ip" : "51.91.152.238", "domain" : "firexperts.in", "suspendreason" : "not suspended", "diskused" : "989M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "firexperts", "plan" : "default", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2120", "maxsql" : "unlimited", "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1 }, { "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1247M", "ip" : "51.254.16.113", "domain" : "jhss.in", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2854", "maxsql" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "jhss", "plan" : "winggolearning_raj", "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 67898, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "26 Apr 13 15:41", "unix_startdate" : 1776075077 }, { "theme" : "jupiter", "maxsql" : "15", "uid" : "1096", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "30", "plan" : "websbook_Unlimited Linux", "user" : "arafcon", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "arafcon.com", "diskused" : "588M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "0", "unix_startdate" : 1631281992, "child_nodes" : [], "startdate" : "21 Sep 10 19:23", "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 1978, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "max_email_per_hour" : "25", "inodesused" : 2813, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1485251316, "startdate" : "17 Jan 24 15:18", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "0", "ip" : "51.91.152.238", "domain" : "bhaviniwelfaresociety.org", "diskused" : "172M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "plan" : "websbook_linux_500mb", "user" : "bhaviniwelfareso", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1110", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5" }, { "startdate" : "23 Jul 19 21:46", "child_nodes" : [], "unix_startdate" : 1689783403, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "sacretcode@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "2048M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 22686, "max_email_per_hour" : "25", "owner" : "thesunda", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "sareencreations", "plan" : "thesunda_Metalart2GB", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1430", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "718M", "domain" : "sareencreations.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0 }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "tsfindia", "plan" : "winggolearning_raj", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2483", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "3683M", "domain" : "tsfindiafoundation.com", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "child_nodes" : [], "startdate" : "24 Aug 29 11:15", "unix_startdate" : 1724910315, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 58896, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "inodesused" : 19832, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "skystechnology", "child_nodes" : [], "startdate" : "24 Mar 01 23:41", "unix_startdate" : 1709316682, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "skystechnology@zohomail.in", "disklimit" : "unlimited", "has_backup" : 0, "domain" : "graceplants.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "642M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "5", "maxaddons" : "5", "user" : "graceplants", "plan" : "skystechnology_skystech_premium_ornests", "outgoing_mail_suspended" : 0, "backup" : 1, "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1395", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited" }, { "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 2402, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0", "unix_startdate" : 1662918996, "startdate" : "22 Sep 11 23:26", "child_nodes" : [], "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "parakhngo.org", "diskused" : "129M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "1229", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "plan" : "websbook_linux_500mb", "user" : "parakhngo", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "domain" : "divyamurjasansthantrust.in", "ip" : "51.254.16.113", "diskused" : "1251M", "suspendreason" : "not suspended", "maxsql" : "unlimited", "uid" : "2765", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "plan" : "winggolearning_raj", "user" : "divyamurjasansth", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 67199, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1770205014, "startdate" : "26 Feb 04 17:06", "child_nodes" : [] }, { "inodesused" : 111111, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "otiyahos", "unix_startdate" : 1657012623, "startdate" : "22 Jul 05 14:47", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "togolais2008@gmail.com", "partition" : "home", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "100000M", "domain" : "sigem.tg", "ip" : "51.91.152.238", "diskused" : "15481M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "10", "plan" : "otiyahos_ECO", "user" : "sigem", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "20", "uid" : "1040", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [] }, { "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 25652, "max_email_per_hour" : "25", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1775818676, "child_nodes" : [], "startdate" : "26 Apr 10 16:27", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "600M", "suspendreason" : "not suspended", "domain" : "shreevatsaeducarefoundation.in", "ip" : "51.254.16.113", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2851", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "sdfasvcskcjbsc" }, { "suspendtime" : 0, "owner" : "websbook", "inodesused" : 2406, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0", "has_backup" : 0, "disklimit" : "200M", "unix_startdate" : 1362126093, "startdate" : "13 Mar 01 13:51", "child_nodes" : [], "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "domain" : "vd-college.org.in", "ip" : "51.91.152.238", "diskused" : "135M", "suspendreason" : "not suspended", "uid" : "1330", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "plan" : "websbook_Linux_100mb", "user" : "vdcolleg", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 11269, "max_email_per_hour" : "50", "owner" : "apkquest", "suspendtime" : 0, "unix_startdate" : 1727749332, "startdate" : "24 Oct 01 07:52", "child_nodes" : [], "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "partition" : "home2", "maxlst" : "5", "has_backup" : 0, "disklimit" : "250M", "maxsub" : "10", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "250M", "suspendreason" : "not suspended", "domain" : "itsvmchatra.org", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "apkquest_250mb", "user" : "itsvmchatra", "maxpop" : "15", "legacy_backup" : 1, "max_defer_fail_percentage" : "10", "ipv6" : [], "uid" : "1361", "maxsql" : "10", "max_emailacct_quota" : "unlimited", "maxftp" : "5", "theme" : "jupiter" }, { "suspendreason" : "not suspended", "diskused" : "910M", "ip" : "51.254.16.113", "domain" : "adorableanimals.in", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "adorableanimals", "plan" : "winggolearning_raj", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2167", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 35586, "owner" : "winggolearning", "suspendtime" : 0, "child_nodes" : [], "startdate" : "24 Nov 22 10:56", "unix_startdate" : 1732253175, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited" }, { "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "uid" : "2677", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "hhtechsolution_H_Basic", "user" : "vigneshbuild", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "246M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "vigneshbuild.com", "has_backup" : 0, "disklimit" : "250M", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "unix_startdate" : 1615792733, "startdate" : "21 Mar 15 12:48", "child_nodes" : [], "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 11291 }, { "unix_startdate" : 1722860670, "startdate" : "24 Aug 05 17:54", "child_nodes" : [], "disklimit" : "1500M", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "maxlst" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 7450, "owner" : "hhtechsolution", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 1, "plan" : "hhtechsolution_H_Adv", "user" : "rktotalholidays", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "10", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2644", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "diskused" : "944M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "rktotalholidays.com", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "user" : "acetecht", "plan" : "Red12Backup", "backup" : 1, "outgoing_mail_suspended" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1001", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "10", "legacy_backup" : 1, "maxpop" : "unlimited", "ip" : "51.91.152.238", "domain" : "acetechtalentz.com", "suspendreason" : "Overdue on Payment", "diskused" : "64976M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "unlimited", "startdate" : "21 Jul 01 10:59", "child_nodes" : [], "unix_startdate" : 1625117341, "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "joshyamanudeep@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home", "max_email_per_hour" : "100", "inodesused" : 636672, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 1751351415, "owner" : "root" }, { "max_email_per_hour" : "25", "inodesused" : 46987, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "24 Nov 15 16:11", "child_nodes" : [], "unix_startdate" : 1731667319, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "ip" : "51.254.16.113", "domain" : "yamcharitabletrust.org", "suspendreason" : "not suspended", "diskused" : "985M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "user" : "yamcharitable", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2510", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited" }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "4", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "ineishaevent.in", "suspendreason" : "not suspended", "diskused" : "905M", "theme" : "jupiter", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "uid" : "2709", "maxsql" : "2", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "3", "legacy_backup" : 0, "user" : "ineishaevent", "plan" : "websbook_linux1000mb_4 addon", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 2239, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "3", "disklimit" : "1000M", "has_backup" : 0, "maxlst" : "1", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "*unknown*", "startdate" : "25 Dec 19 12:27", "child_nodes" : [], "unix_startdate" : 1766127439 }, { "unix_startdate" : 1769508673, "child_nodes" : [], "startdate" : "26 Jan 27 15:41", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 67302, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "plan" : "winggolearning_raj", "user" : "garif", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "2755", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "ip" : "51.254.16.113", "domain" : "garif.in", "diskused" : "1214M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "kppvtiti", "plan" : "apkquest_250mb", "ipv6" : [], "max_defer_fail_percentage" : "10", "legacy_backup" : 1, "maxpop" : "15", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "5", "maxsql" : "10", "uid" : "1365", "suspendreason" : "not suspended", "diskused" : "47M", "ip" : "51.91.152.238", "domain" : "kppvtiti.com", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "child_nodes" : [], "startdate" : "24 Oct 03 09:18", "unix_startdate" : 1727927328, "disklimit" : "250M", "has_backup" : 0, "maxlst" : "5", "email" : "shiv2144@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "10", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 1391, "owner" : "apkquest", "suspendtime" : 0 }, { "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1770646323, "startdate" : "26 Feb 09 19:42", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 43300, "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2774", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "rajgondsangramse", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "971M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "rajgondsangramsena.in" }, { "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1519M", "domain" : "mahavirnarayanjctrust.in", "ip" : "51.254.16.113", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2570", "maxsql" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "mahavirnarayan", "plan" : "winggolearning_raj", "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 50203, "max_email_per_hour" : "25", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "25 Nov 21 15:23", "unix_startdate" : 1763718791 }, { "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 1295, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "child_nodes" : [], "startdate" : "23 May 11 12:10", "unix_startdate" : 1683787208, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "vaseraindiango.org.in", "suspendreason" : "not suspended", "diskused" : "35M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "1173", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "user" : "indiavaserango", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "startdate" : "25 Jan 22 11:18", "child_nodes" : [], "unix_startdate" : 1737524909, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 43383, "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "scjp", "plan" : "default", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2433", "maxsql" : "unlimited", "suspendreason" : "not suspended", "diskused" : "1054M", "ip" : "51.254.16.113", "domain" : "jpscfoundation.co.in", "maxparked" : "1", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0 }, { "diskused" : "937M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "samridhandshikshitbharattrust.in", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "samridhandshiksh", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2410", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 45525, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1748073839, "startdate" : "25 May 24 13:33", "child_nodes" : [], "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited" }, { "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "2", "uid" : "1343", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_7GB", "user" : "yauvanyacom", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "3100M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "yauvanya.com", "has_backup" : 0, "disklimit" : "7168M", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1688114344, "child_nodes" : [], "startdate" : "23 Jun 30 14:09", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 30983 }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "10", "domain" : "missiondesjeunestogo.org", "ip" : "51.91.152.238", "diskused" : "2291M", "suspendreason" : "not suspended", "maxsql" : "20", "uid" : "1063", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "otiyahos_ECO", "user" : "missiondesjeunes", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "otiyahos", "inodesused" : 39624, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "agenceotiya@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "unlimited", "disklimit" : "100000M", "has_backup" : 0, "unix_startdate" : 1729847380, "child_nodes" : [], "startdate" : "24 Oct 25 14:39" }, { "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2477", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "user" : "tanmayfoundation", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "tanmayfoundation.com", "suspendreason" : "not suspended", "diskused" : "1137M", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "child_nodes" : [], "startdate" : "24 Apr 04 18:03", "unix_startdate" : 1712234030, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 36613, "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "theme" : "jupiter", "uid" : "2328", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "ashutosh_dev_makemytuition", "user" : "makemytuition", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "5", "ip" : "51.254.16.113", "domain" : "makemytuition.com", "diskused" : "2064M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "18000M", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "unix_startdate" : 1663422112, "child_nodes" : [], "startdate" : "22 Sep 17 19:11", "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 103867, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 10, "max_email_per_hour" : "25", "owner" : "hhtechsolution", "suspendtime" : 0, "unix_startdate" : 1706005257, "startdate" : "24 Jan 23 15:50", "child_nodes" : [], "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "250M", "has_backup" : 0, "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "251M", "suspendreason" : "not suspended", "domain" : "ktsvwfgc.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "hhtechsolution_H_Basic", "user" : "ktsvwfgc", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2631", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter" }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "nhrpc.co.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1304M", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2360", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "user" : "nhrpc", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 42066, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Apr 01 19:02", "unix_startdate" : 1711978362 }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "mahilavidhyamandirsabha.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "100M", "maxftp" : "5", "max_emailacct_quota" : "unlimited", "maxsql" : "10", "uid" : "1369", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "15", "ipv6" : [], "max_defer_fail_percentage" : "10", "user" : "mahilavidhyamand", "plan" : "apkquest_250mb", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "apkquest", "inodesused" : 1123, "max_email_per_hour" : "50", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "10", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "5", "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "250M", "startdate" : "24 Oct 03 09:25", "child_nodes" : [], "unix_startdate" : 1727927755 }, { "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "disklimit" : "250M", "has_backup" : 0, "child_nodes" : [], "startdate" : "23 Dec 27 16:20", "unix_startdate" : 1703674257, "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 1783, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "2653", "maxsql" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "sahayaindiafound", "plan" : "hhtechsolution_H_Basic", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "sahayaindiafoundation.org", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "154M" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "awadhswabhiman", "plan" : "winggolearning_raj", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2195", "maxsql" : "unlimited", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "1124M", "domain" : "awadhswabhimantrust.org", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "child_nodes" : [], "startdate" : "25 Feb 22 12:19", "unix_startdate" : 1740206959, "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 81516, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "ip" : "51.254.16.113", "domain" : "muktifoundation.co.in", "suspendreason" : "not suspended", "diskused" : "967M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "user" : "muktifoundation", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2682", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "max_email_per_hour" : "25", "inodesused" : 47112, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "25 Dec 05 17:47", "child_nodes" : [], "unix_startdate" : 1764937059, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "vaishnaviedu", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2518", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "diskused" : "917M", "suspendreason" : "not suspended", "domain" : "vaishnavieduandsoclwelfaresociety.org", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1751366820, "startdate" : "25 Jul 01 16:17", "child_nodes" : [], "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 44856, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "disklimit" : "1500M", "has_backup" : 0, "maxlst" : "1", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "startdate" : "25 Oct 09 12:36", "child_nodes" : [], "unix_startdate" : 1759993576, "suspendtime" : 0, "owner" : "hhtechsolution", "max_email_per_hour" : "25", "inodesused" : 802, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "2629", "maxsql" : "1", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "10", "user" : "jssms", "plan" : "hhtechsolution_H_Adv", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "jssms.in", "suspendreason" : "not suspended", "diskused" : "50M" }, { "maxaddons" : "unlimited", "maxparked" : "unlimited", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "6197M", "domain" : "websitez.in", "ip" : "51.91.152.238", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1340", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "wadmin", "plan" : "websiteg_unlimited_Real", "owner" : "websiteg", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 54839, "max_email_per_hour" : "25", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "websitez.in@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "19 Jun 05 00:53", "child_nodes" : [], "unix_startdate" : 1559676185 }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_Linux_100mb", "user" : "ptkripas", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxsql" : "1", "uid" : "1244", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "74M", "suspendreason" : "not suspended", "domain" : "swkripashankartiwarimahavidyalaya.org.in", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1362127565, "startdate" : "13 Mar 01 14:16", "child_nodes" : [], "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0", "has_backup" : 0, "disklimit" : "200M", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1976, "max_email_per_hour" : "unlimited", "owner" : "websbook", "suspendtime" : 0 }, { "domain" : "samarpansho.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "151M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "samarpan", "plan" : "thesunda_cine1024", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "5", "uid" : "1429", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "3", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "inodesused" : 4300, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "thesunda", "child_nodes" : [], "startdate" : "25 Jan 25 13:56", "unix_startdate" : 1737793608, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "email" : "sacretcode@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "1024M", "has_backup" : 0 }, { "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 733, "has_backup" : 0, "disklimit" : "200M", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "unix_startdate" : 1504957495, "child_nodes" : [], "startdate" : "17 Sep 09 17:14", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "17M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "gdrsmahavidyalaya.org.in", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1156", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_Linux_100mb", "user" : "gdrsmahavidyalay" }, { "owner" : "royaldiagnosticc", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 19594, "max_email_per_hour" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "25 Mar 08 13:21", "child_nodes" : [], "unix_startdate" : 1741420305, "maxparked" : "1", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "247M", "domain" : "surjyalab.in", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1497", "maxsql" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "surjyalab", "plan" : "royaldiagnosticc_Unlimited plan" }, { "theme" : "jupiter", "uid" : "1021", "maxsql" : "20", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "otiyahos_ECO", "user" : "giprecyclage", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "10", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "giprecyclage.org", "diskused" : "8744M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "100000M", "has_backup" : 0, "email" : "togolais2008@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "unlimited", "unix_startdate" : 1649966596, "child_nodes" : [], "startdate" : "22 Apr 15 01:33", "suspendtime" : 0, "owner" : "otiyahos", "max_email_per_hour" : "25", "inodesused" : 36628, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "suspendreason" : "not suspended", "diskused" : "137M", "ip" : "51.91.152.238", "domain" : "acece-sa.com", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "acecesa", "plan" : "hhtechsolution_H_Adv", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "10", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "2587", "maxsql" : "1", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 790, "owner" : "hhtechsolution", "suspendtime" : 0, "child_nodes" : [], "startdate" : "24 Oct 16 22:51", "unix_startdate" : 1729099299, "has_backup" : 0, "disklimit" : "1500M", "maxlst" : "1", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5" }, { "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2381", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "pragyanfoundatio", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "pragyanfoundation.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "894M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "startdate" : "25 Sep 25 10:55", "child_nodes" : [], "unix_startdate" : 1758777937, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 42263, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "has_backup" : 0, "disklimit" : "100000M", "outgoing_mail_hold" : 0, "email" : "agenceotiya@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1777881883, "child_nodes" : [], "startdate" : "26 May 04 13:34", "owner" : "otiyahos", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/usr/local/cpanel/bin/noshell", "max_email_per_hour" : "25", "inodesused" : 168106, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "maxsql" : "20", "uid" : "2884", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "otiyahos_ECO", "user" : "megasports", "maxparked" : "0", "maxaddons" : "10", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "16385M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "megasports.tg" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 16831, "max_email_per_hour" : "25", "owner" : "topweblogic", "suspendtime" : 0, "startdate" : "24 Jun 15 15:25", "child_nodes" : [], "unix_startdate" : 1718445313, "maxlst" : "25", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "1000M", "has_backup" : 0, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "837M", "domain" : "designcell.biz", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "designcell", "plan" : "topweblogic_Silver Package", "maxpop" : "10", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "2", "uid" : "2152", "theme" : "jupiter" }, { "child_nodes" : [], "startdate" : "25 Dec 08 22:13", "unix_startdate" : 1765212214, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "disklimit" : "250M", "has_backup" : 0, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 217, "max_email_per_hour" : "25", "owner" : "hhtechsolution", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "jupitercorporati", "plan" : "hhtechsolution_H_Basic", "legacy_backup" : 0, "maxpop" : "5", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2689", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "10M", "domain" : "jupitercorporation.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0 }, { "inodeslimit" : "unlimited", "suspended" : 1, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "email" : "onedestinyahead@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1715242495, "child_nodes" : [], "startdate" : "24 May 09 13:44", "suspendtime" : 1778221816, "owner" : "pawsnmei", "max_email_per_hour" : "unlimited", "inodesused" : 19341, "mailbox_format" : "maildir", "shell" : "/bin/false", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1523", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "default", "user" : "rusomadmin", "outgoing_mail_suspended" : 1, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "rusom.in", "diskused" : "589M", "suspendreason" : "Overdue on Payment" }, { "inodesused" : 17351, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "livechen", "unix_startdate" : 1694047855, "child_nodes" : [], "startdate" : "23 Sep 07 06:20", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "domain" : "demo.chennaiwebstores.com", "ip" : "51.91.152.238", "diskused" : "712M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "unlimited", "maxaddons" : "unlimited", "plan" : "livechen_Unlimitted", "user" : "demochennaiwebst", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "1137", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "20" }, { "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "91M", "domain" : "mmitkaushambi.com", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "3", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1420", "maxsql" : "5", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "mmitka", "plan" : "thesunda_cine1024", "owner" : "thesunda", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 1474, "max_email_per_hour" : "25", "maxlst" : "0", "partition" : "home2", "email" : "avi.sinh@gmail.com", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "1024M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "24 Nov 20 13:42", "child_nodes" : [], "unix_startdate" : 1732090379 }, { "ip" : "51.91.152.238", "domain" : "sjsjuniorhighschool.org.in", "suspendreason" : "not suspended", "diskused" : "23M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "sjsjuniorhighsch", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "1296", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "max_email_per_hour" : "25", "inodesused" : 750, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "startdate" : "22 Feb 14 16:48", "child_nodes" : [], "unix_startdate" : 1644837522, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 44768, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1742800641, "child_nodes" : [], "startdate" : "25 Mar 24 12:47", "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "diskused" : "968M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "naurangd.com", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "naurangd", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2350", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited" }, { "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2475", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "user" : "swastika", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "swastikadeaddiction.in", "suspendreason" : "not suspended", "diskused" : "845M", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "startdate" : "24 Jun 17 11:45", "child_nodes" : [], "unix_startdate" : 1718604908, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 29250, "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "owner" : "hhtechsolution", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 852, "has_backup" : 0, "disklimit" : "250M", "maxlst" : "unlimited", "partition" : "home2", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "child_nodes" : [], "startdate" : "24 Mar 22 22:12", "unix_startdate" : 1711125769, "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "72M", "ip" : "51.91.152.238", "domain" : "rowaterpurifierservicecenter.com", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "2643", "maxsql" : "1", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "romiswaterpurif", "plan" : "hhtechsolution_H_Basic" }, { "inodesused" : 20931, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "topweblogic", "unix_startdate" : 1683032903, "startdate" : "23 May 02 18:38", "child_nodes" : [], "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "topweblogic@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "25", "disklimit" : "1000M", "has_backup" : 0, "domain" : "dynamicengg.co", "ip" : "51.91.152.238", "diskused" : "774M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "plan" : "topweblogic_Silver Package", "user" : "enggdynami", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "2", "uid" : "2119", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "10", "max_defer_fail_percentage" : "unlimited", "ipv6" : [] }, { "unix_startdate" : 1772856867, "startdate" : "26 Mar 07 09:44", "child_nodes" : [], "maxsub" : "10", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "shiv2144@gmail.com", "maxlst" : "5", "has_backup" : 0, "disklimit" : "250M", "inodesused" : 383, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "apkquest", "plan" : "apkquest_250mb", "user" : "kplawcollege", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "2801", "maxsql" : "10", "maxftp" : "5", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "15", "legacy_backup" : 0, "max_defer_fail_percentage" : "10", "ipv6" : [], "domain" : "kplawcollege.com", "ip" : "51.91.152.238", "diskused" : "26M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0" }, { "domain" : "chetnaindia.org.in", "ip" : "51.91.152.238", "diskused" : "33M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "plan" : "websbook_linux_500mb", "user" : "chetnaorgindia", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "1", "uid" : "1120", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "inodesused" : 1284, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1725344605, "child_nodes" : [], "startdate" : "24 Sep 03 11:53", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M" }, { "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "startdate" : "25 Jul 16 17:08", "child_nodes" : [], "unix_startdate" : 1752665931, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 45441, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2327", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "user" : "mahirajwelfare", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "mahirajwelfarefoundation.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "951M" }, { "uid" : "2616", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "plan" : "hhtechsolution_H_Basic", "user" : "homewaypackers", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "homewaypackers.in", "ip" : "51.91.152.238", "diskused" : "309M", "suspendreason" : "not suspended", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "250M", "unix_startdate" : 1673350715, "child_nodes" : [], "startdate" : "23 Jan 10 17:08", "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 9, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1712384402, "startdate" : "24 Apr 06 11:50", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 32402, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2186", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "ashishayush", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1188M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "ashishayushfederation.in" }, { "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 933, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "250M", "has_backup" : 0, "unix_startdate" : 1732173356, "startdate" : "24 Nov 21 12:45", "child_nodes" : [], "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "alwadiarabia.com", "ip" : "51.91.152.238", "diskused" : "122M", "suspendreason" : "not suspended", "maxsql" : "1", "uid" : "2592", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "plan" : "hhtechsolution_H_Basic", "user" : "alwadiarabia", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "empowerehp", "plan" : "winggolearning_raj", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2246", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "926M", "domain" : "empowerehp.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "startdate" : "25 Aug 08 13:20", "child_nodes" : [], "unix_startdate" : 1754639415, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 45296, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 633, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0, "unix_startdate" : 1423991200, "child_nodes" : [], "startdate" : "15 Feb 15 14:36", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "10M", "suspendreason" : "not suspended", "domain" : "sitadeviyapvtiti.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "sitadeviyapvtiti", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "maxsql" : "1", "uid" : "1294", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "bajrangvahin", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2197", "maxsql" : "unlimited", "suspendreason" : "not suspended", "diskused" : "930M", "ip" : "51.254.16.113", "domain" : "yuvabajrangvahini.in", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "child_nodes" : [], "startdate" : "25 Sep 18 18:24", "unix_startdate" : 1758200064, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 42470, "owner" : "winggolearning", "suspendtime" : 0 }, { "startdate" : "17 Dec 28 18:07", "child_nodes" : [], "unix_startdate" : 1514464633, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "topweblogic@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "*unknown*", "inodesused" : 122569, "owner" : "topweblogic", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "platinummotelcom", "plan" : "default", "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2135", "suspendreason" : "not suspended", "diskused" : "5383M", "ip" : "51.91.152.238", "domain" : "platinummotel.com.au", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0 }, { "max_email_per_hour" : "25", "inodesused" : 277, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "topweblogic", "unix_startdate" : 1772782146, "startdate" : "26 Mar 06 12:59", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "disklimit" : "2000M", "has_backup" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "topweblogic@gmail.com", "maxlst" : "25", "ip" : "51.91.152.238", "domain" : "nexusexportsandshipping.com", "diskused" : "21M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "plan" : "topweblogic_Gold Package", "user" : "nexusexportsand", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "2800", "maxsql" : "5", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "10" }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "shedhybrid.com", "suspendreason" : "not suspended", "diskused" : "1266M", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2441", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "user" : "shedhybrid", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 26190, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "child_nodes" : [], "startdate" : "24 Feb 22 14:11", "unix_startdate" : 1708591313 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "sntpharmacy", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "uid" : "1307", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "diskused" : "24M", "suspendreason" : "not suspended", "domain" : "sntcollegeofpharmacy.org.in", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1660199577, "child_nodes" : [], "startdate" : "22 Aug 11 12:02", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1138, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0 }, { "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "235M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "shrivishwashantiashram.org", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxsql" : "1", "uid" : "1318", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500mb", "user" : "svsashram", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 2131, "disklimit" : "500M", "has_backup" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "unix_startdate" : 1409588927, "child_nodes" : [], "startdate" : "14 Sep 01 21:58" }, { "unix_startdate" : 1715116040, "startdate" : "24 May 08 02:37", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 1, "maxsub" : "unlimited", "disklimit" : "50000M", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "onedestinyahead@gmail.com", "maxlst" : "unlimited", "max_email_per_hour" : "unlimited", "inodesused" : 4881, "mailbox_format" : "maildir", "shell" : "/bin/false", "suspendtime" : 1778221815, "owner" : "root", "plan" : "RED901RESELLER", "user" : "pawsnmei", "outgoing_mail_suspended" : 1, "backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1519", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "ip" : "51.91.152.238", "domain" : "pawsnme.in", "diskused" : "128M", "suspendreason" : "Overdue on Payment", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_Linux_100mb", "user" : "shrisaty", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "uid" : "1291", "maxsql" : "1", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "16M", "suspendreason" : "not suspended", "domain" : "shrisatyadevdegreecollege.org", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1362236411, "startdate" : "13 Mar 02 20:30", "child_nodes" : [], "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "disklimit" : "200M", "has_backup" : 0, "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 411, "max_email_per_hour" : "unlimited", "owner" : "websbook", "suspendtime" : 0 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "skjsfoundation", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2842", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "diskused" : "847M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "skjsfoundation.in", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1775648441, "startdate" : "26 Apr 08 17:10", "child_nodes" : [], "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 68882, "owner" : "winggolearning", "suspendtime" : 0 }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "child_nodes" : [], "startdate" : "22 Jun 06 11:18", "unix_startdate" : 1654494531, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 1484, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1107", "maxsql" : "1", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "user" : "bdkaintercollege", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "bdkaintercollege.org.in", "suspendreason" : "not suspended", "diskused" : "38M" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 19468, "max_email_per_hour" : "30", "owner" : "royaldiagnosticc", "suspendtime" : 0, "unix_startdate" : 1681911686, "startdate" : "23 Apr 19 19:11", "child_nodes" : [], "outgoing_mail_hold" : 0, "email" : "ASHIQULRAHMAN175@GMAIL.COM", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "589M", "suspendreason" : "not suspended", "domain" : "metacarebpt.in", "ip" : "51.91.152.238", "maxparked" : "1", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "royaldiagnosticc_Unlimited plan", "user" : "metacarebpt", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "uid" : "1482", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter" }, { "plan" : "websbook_linux_500mb", "user" : "researchcreative", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "1256", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "creativeresearch.in", "diskused" : "125M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "unix_startdate" : 1574582989, "child_nodes" : [], "startdate" : "19 Nov 24 13:39", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0", "max_email_per_hour" : "25", "inodesused" : 1091, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook" }, { "unix_startdate" : 1727952999, "startdate" : "24 Oct 03 16:26", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 39674, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "plan" : "winggolearning_raj", "user" : "humanrelief", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "2277", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "humanrelieffoundation.in", "ip" : "51.254.16.113", "diskused" : "1012M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "murlimanoharsewa", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2746", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "833M", "suspendreason" : "not suspended", "domain" : "murlimanoharsewafoundation.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1768655022, "startdate" : "26 Jan 17 18:33", "child_nodes" : [], "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 66331, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "user" : "skpallahabad", "plan" : "apkquest_250mb", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "5", "max_emailacct_quota" : "unlimited", "maxsql" : "10", "uid" : "1378", "theme" : "jupiter", "maxpop" : "15", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "10", "domain" : "skpallahabad.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "274M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "startdate" : "24 Oct 03 09:51", "child_nodes" : [], "unix_startdate" : 1727929269, "maxsub" : "10", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "5", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "has_backup" : 0, "disklimit" : "250M", "inodesused" : 9, "max_email_per_hour" : "50", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "apkquest" }, { "plan" : "winggolearning_raj", "user" : "shribalajijansha", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "2447", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "shribalajijanshaktifoundationtrust.in", "ip" : "51.254.16.113", "diskused" : "934M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "unix_startdate" : 1746614951, "child_nodes" : [], "startdate" : "25 May 07 16:19", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 42924, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning" }, { "max_email_per_hour" : "25", "inodesused" : 58177, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "25 Dec 06 11:09", "child_nodes" : [], "unix_startdate" : 1764999593, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "ip" : "51.254.16.113", "domain" : "khushahalivikashsansthan.in", "suspendreason" : "not suspended", "diskused" : "1289M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "user" : "khushahalivikash", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2684", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0 }, { "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "1052M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "bharatgyansewatrust.org", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2200", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "bharatgyansewa", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 37302, "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1721392007, "child_nodes" : [], "startdate" : "24 Jul 19 17:56" }, { "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxftp" : "10", "max_emailacct_quota" : "unlimited", "uid" : "1043", "maxsql" : "20", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "sportculturenews", "plan" : "otiyahos_ECO", "maxparked" : "0", "maxaddons" : "10", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "15365M", "domain" : "sportculturenews.tg", "ip" : "51.91.152.238", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "togolais2008@gmail.com", "has_backup" : 0, "disklimit" : "100000M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Jan 05 12:02", "unix_startdate" : 1704436359, "owner" : "otiyahos", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 111519, "max_email_per_hour" : "25" }, { "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2452", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "shriramnavyug", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "2497M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "shriramnavyugtrust.org", "has_backup" : 0, "disklimit" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1737267086, "startdate" : "25 Jan 19 11:41", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 133034 }, { "outgoing_mail_suspended" : 1, "backup" : 1, "user" : "narayanee", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2347", "suspendreason" : "not suspended", "diskused" : "1677M", "ip" : "51.254.16.113", "domain" : "narayanee.online", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "startdate" : "25 Aug 16 12:45", "child_nodes" : [], "unix_startdate" : 1755328532, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 188025, "owner" : "winggolearning", "suspendtime" : 0 }, { "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1766569456, "startdate" : "25 Dec 24 15:14", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 72808, "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2717", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "newmargdarshantr", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "1319M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "newmargdarshantrust.com" }, { "maxaddons" : "unlimited", "maxparked" : "unlimited", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "292M", "suspendreason" : "not suspended", "domain" : "news.chennaiwebstores.com", "ip" : "51.91.152.238", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "maxsql" : "unlimited", "uid" : "1227", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "livechen_Unlimitted", "user" : "newschennaiwebst", "owner" : "livechen", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 7309, "max_email_per_hour" : "25", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "spsuresh54@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1739915832, "startdate" : "25 Feb 19 03:27", "child_nodes" : [] }, { "suspendreason" : "not suspended", "diskused" : "1948M", "domain" : "ciaindia.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "ciaindia", "plan" : "winggolearning_raj", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2216", "theme" : "jupiter", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 54430, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "24 Oct 14 18:53", "child_nodes" : [], "unix_startdate" : 1728912212, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited" }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "shrigangesewasansthan.in", "suspendreason" : "not suspended", "diskused" : "931M", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2448", "maxsql" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "user" : "shrigange", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 44316, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "child_nodes" : [], "startdate" : "25 Apr 22 11:27", "unix_startdate" : 1745301438 }, { "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "2602", "maxsql" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "coolairconeng", "plan" : "hhtechsolution_H_Basic", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "8M", "domain" : "coolairconeng.com", "ip" : "51.91.152.238", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "disklimit" : "250M", "has_backup" : 0, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "25 Apr 05 22:08", "unix_startdate" : 1743871097, "owner" : "hhtechsolution", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 274, "max_email_per_hour" : "25" }, { "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2435", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "sesfoundation", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "955M", "suspendreason" : "not suspended", "domain" : "sesfoundation.in", "ip" : "51.254.16.113", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1724162113, "child_nodes" : [], "startdate" : "24 Aug 20 19:25", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 45938, "max_email_per_hour" : "25" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 30482, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1756289310, "startdate" : "25 Aug 27 15:38", "child_nodes" : [], "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "666M", "suspendreason" : "not suspended", "domain" : "allindiaemployeeassociation.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "allindiaemployee", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2178", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter" }, { "unix_startdate" : 1720520190, "startdate" : "24 Jul 09 15:46", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 29657, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "plan" : "winggolearning_raj", "user" : "rmwt", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "2397", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "rmwt.in", "ip" : "51.254.16.113", "diskused" : "897M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1" }, { "unix_startdate" : 1767008871, "child_nodes" : [], "startdate" : "25 Dec 29 17:17", "has_backup" : 0, "disklimit" : "2000M", "partition" : "home2", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "25", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 32699, "owner" : "topweblogic", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "topweblogic_Gold Package", "user" : "tibro", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "10", "legacy_backup" : 0, "theme" : "jupiter", "uid" : "2722", "maxsql" : "5", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "diskused" : "1352M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "orbit007.co.uk", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "inodesused" : 66515, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1765604908, "startdate" : "25 Dec 13 11:18", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "domain" : "rmnkanyadaansocialfoundation.in", "ip" : "51.254.16.113", "diskused" : "825M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "plan" : "winggolearning_raj", "user" : "rmnkanyadaansoci", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "2699", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30" }, { "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2157", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "user" : "tengrollershutte", "plan" : "default", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "tengrollershutters.com.au", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "1428M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "child_nodes" : [], "startdate" : "24 Mar 07 16:12", "unix_startdate" : 1709808136, "suspendtime" : 0, "owner" : "topweblogic", "inodesused" : 48125, "max_email_per_hour" : "*unknown*", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "max_email_per_hour" : "unlimited", "inodesused" : 7989, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1363679592, "startdate" : "13 Mar 19 13:23", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "7168M", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "unlimited", "ip" : "51.91.152.238", "domain" : "hnbpgcollegealld.org.in", "diskused" : "6035M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "plan" : "websbook_linux_7GB", "user" : "hnbpgcol", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxsql" : "2", "uid" : "1165", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1 }, { "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "348M", "suspendreason" : "not suspended", "domain" : "ngotears.org", "ip" : "51.91.152.238", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxsql" : "2", "uid" : "1320", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_1000 MB Linux", "user" : "tearsngo", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 3885, "max_email_per_hour" : "25", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "1", "has_backup" : 0, "disklimit" : "1000M", "maxsub" : "3", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1746039343, "startdate" : "25 May 01 00:25", "child_nodes" : [] }, { "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1431", "maxsql" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "sareenint", "plan" : "thesunda_Metalart2GB", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "924M", "ip" : "51.91.152.238", "domain" : "sareeninternational.com", "disklimit" : "2048M", "has_backup" : 0, "maxlst" : "unlimited", "email" : "ssharma64644@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "23 Oct 21 07:00", "unix_startdate" : 1697851830, "owner" : "thesunda", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 19669 }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "shrimatiindia.org", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1187M", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2450", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "user" : "shrimatiindia", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 52052, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "startdate" : "25 May 06 18:20", "child_nodes" : [], "unix_startdate" : 1746535850 }, { "maxlst" : "0", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "19 Sep 04 19:47", "unix_startdate" : 1567606660, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 1280, "max_email_per_hour" : "25", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1099", "maxsql" : "1", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "atarsinghdegreec", "plan" : "websbook_linux_500mb", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "34M", "domain" : "atarsinghdegreecollege.org.in", "ip" : "51.91.152.238" }, { "plan" : "linqindo_Premium", "user" : "amigopartyhall", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "1444", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "amigopartyhall.com", "diskused" : "61M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "unlimited", "maxaddons" : "0", "unix_startdate" : 1700584895, "startdate" : "23 Nov 21 22:11", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "email" : "afsaldigimarketing@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 561, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "linqindo" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "mcdet", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2332", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "diskused" : "885M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "mcdet.co.in", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1731563374, "child_nodes" : [], "startdate" : "24 Nov 14 11:19", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 37333, "owner" : "winggolearning", "suspendtime" : 0 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "shreekapalikakha", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2444", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "913M", "suspendreason" : "not suspended", "domain" : "shreekapalikakhadafoundation.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1748874736, "child_nodes" : [], "startdate" : "25 Jun 02 20:02", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 69879, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "1", "uid" : "2628", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "hhtechsolution_H_Basic", "user" : "jgspices", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "37M", "suspendreason" : "not suspended", "domain" : "jgspices.in", "ip" : "51.91.152.238", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited", "disklimit" : "250M", "has_backup" : 0, "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1757500582, "startdate" : "25 Sep 10 16:06", "child_nodes" : [], "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 735, "max_email_per_hour" : "25" }, { "diskused" : "912M", "suspendreason" : "not suspended", "domain" : "sbsct.co.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "sbsct", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2431", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 44379, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1752914087, "startdate" : "25 Jul 19 14:04", "child_nodes" : [], "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "uid" : "1264", "maxsql" : "2", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 1, "backup" : 1, "plan" : "websbook_1000 MB Linux", "user" : "rnsmahav", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "501M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "rnsmahavidyalaya.com", "has_backup" : 0, "disklimit" : "1000M", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "3", "unix_startdate" : 1362235423, "child_nodes" : [], "startdate" : "13 Mar 02 20:13", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 4658 }, { "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "startdate" : "25 Nov 04 12:56", "child_nodes" : [], "unix_startdate" : 1762241174, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 45284, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2553", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "user" : "parajempowerment", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "parajempowermentfoundation.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1019M" }, { "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxsql" : "unlimited", "uid" : "1155", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "livechen_Unlimitted", "user" : "gainpay", "maxparked" : "unlimited", "maxaddons" : "unlimited", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "864M", "suspendreason" : "not suspended", "domain" : "gainpay.chennaiwebstores.com", "ip" : "51.91.152.238", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1681958608, "child_nodes" : [], "startdate" : "23 Apr 20 08:13", "owner" : "livechen", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 20538, "max_email_per_hour" : "25" }, { "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "500M", "child_nodes" : [], "startdate" : "19 Dec 03 06:16", "unix_startdate" : 1575333971, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 601, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1093", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "user" : "amaritiorg", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "amariti.org.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "13M" }, { "inodesused" : 212824, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/false", "suspendtime" : 1778221818, "owner" : "root", "unix_startdate" : 1746646005, "child_nodes" : [], "startdate" : "25 May 08 00:56", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 1, "outgoing_mail_hold" : 0, "email" : "nathanidhaval099@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "domain" : "sccgodhra.in", "ip" : "51.91.152.238", "diskused" : "13876M", "suspendreason" : "Overdue on Payment", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "unlimited", "plan" : "RED91SSD", "user" : "sccgodh2", "backup" : 1, "outgoing_mail_suspended" : 1, "uid" : "2793", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [] }, { "maxparked" : "unlimited", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1302M", "domain" : "aryainc.in", "ip" : "51.91.152.238", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1391", "maxsql" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "aryainc", "plan" : "root_unlimited", "owner" : "skystechnology", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 7454, "max_email_per_hour" : "25", "maxlst" : "unlimited", "email" : "mamathasmps5@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "23 Nov 07 13:34", "child_nodes" : [], "unix_startdate" : 1699344294 }, { "diskused" : "1M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "local.test", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "default", "user" : "local", "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "uid" : "2873", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "mailbox_format" : "maildir", "shell" : "/usr/local/cpanel/bin/noshell", "max_email_per_hour" : "*unknown*", "inodesused" : 83, "owner" : "local", "suspendtime" : 0, "unix_startdate" : 1777592123, "child_nodes" : [], "startdate" : "26 May 01 05:05", "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited" }, { "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "uid" : "2548", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "resawkhfoundatio", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1014M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "resawkhfoundation.in", "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1761649189, "startdate" : "25 Oct 28 16:29", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 43782 }, { "owner" : "thesunda", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 9472, "max_email_per_hour" : "25", "maxlst" : "0", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "sacretcode@gmail.com", "has_backup" : 0, "disklimit" : "1024M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "25 Aug 01 01:44", "child_nodes" : [], "unix_startdate" : 1753992855, "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "313M", "domain" : "karatesiblings.com", "ip" : "51.91.152.238", "maxpop" : "3", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "5", "uid" : "1978", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "karatesiblings", "plan" : "thesunda_cine1024" }, { "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 4311, "max_email_per_hour" : "25", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1362235992, "startdate" : "13 Mar 02 20:23", "child_nodes" : [], "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "212M", "suspendreason" : "not suspended", "domain" : "maavaishnavidegreecollege.org", "ip" : "51.91.152.238", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxsql" : "1", "uid" : "1203", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500mb", "user" : "maavais" }, { "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "uid" : "2811", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "womenwingssociet", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "826M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "womenwingssociety.com", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1773482767, "startdate" : "26 Mar 14 15:36", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 67440 }, { "owner" : "root", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 25942, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "gloryconcepts@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "23 Dec 05 21:19", "child_nodes" : [], "unix_startdate" : 1701791340, "maxaddons" : "0", "maxparked" : "unlimited", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1413M", "ip" : "51.91.152.238", "domain" : "cipindia.co.in", "max_defer_fail_percentage" : "5", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1531", "maxsql" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "cipindia", "plan" : "RED12HOSTING" }, { "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "957M", "ip" : "51.254.16.113", "domain" : "svjst.in", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2473", "maxsql" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "svjst", "plan" : "winggolearning_raj", "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 44926, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "25 Apr 30 17:13", "unix_startdate" : 1746013419 }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 16234, "owner" : "topweblogic", "suspendtime" : 0, "unix_startdate" : 1635509322, "child_nodes" : [], "startdate" : "21 Oct 29 17:38", "disklimit" : "1000M", "has_backup" : 0, "email" : "topweblogic@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "25", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "diskused" : "354M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "shreeshaktifibreinsulation.in", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "topweblogic_Silver Package", "user" : "shreeshaktifibre", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "10", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "2", "uid" : "2142", "maxftp" : "1", "max_emailacct_quota" : "unlimited" }, { "domain" : "svbpeducationalsociety.org", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "18M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "svbpeduc", "plan" : "websbook_Linux_100mb", "outgoing_mail_suspended" : 0, "backup" : 1, "max_emailacct_quota" : "unlimited", "maxftp" : "0", "uid" : "1317", "maxsql" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "inodesused" : 623, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "child_nodes" : [], "startdate" : "18 Sep 16 19:03", "unix_startdate" : 1537104825, "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "has_backup" : 0, "disklimit" : "200M" }, { "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2785", "maxsql" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "prakratikbharat", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "963M", "ip" : "51.254.16.113", "domain" : "prakratikbharat.org", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "26 Feb 19 15:50", "child_nodes" : [], "unix_startdate" : 1771496449, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 68627 }, { "owner" : "apkquest", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 95491, "has_backup" : 0, "disklimit" : "2048M", "maxlst" : "unlimited", "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "25 Sep 05 15:51", "unix_startdate" : 1757067669, "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "928M", "ip" : "51.91.152.238", "domain" : "yesduniya.in", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1984", "maxsql" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "yesduniya", "plan" : "apkquest_2gb" }, { "child_nodes" : [], "startdate" : "22 Feb 20 19:52", "unix_startdate" : 1645366930, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "sacretcode@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 12956, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "thesunda", "user" : "gulabpublic", "plan" : "default", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1410", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "domain" : "gulabpublicschool.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "1697M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0" }, { "inodesused" : 1434, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1714493444, "startdate" : "24 Apr 30 21:40", "child_nodes" : [], "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "domain" : "portacabinsroboa.org", "ip" : "51.91.152.238", "diskused" : "134M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "plan" : "websbook_linux_500mb", "user" : "portaroboacabins", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "1", "uid" : "1238", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [] }, { "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 216, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1751523354, "child_nodes" : [], "startdate" : "25 Jul 03 11:45", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "domain" : "udyalaemfoundation.in", "ip" : "51.254.16.113", "diskused" : "6M", "suspendreason" : "not suspended", "maxsql" : "unlimited", "uid" : "2485", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "plan" : "winggolearning_raj", "user" : "udyalaem", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "maxparked" : "5", "maxaddons" : "5", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "621M", "ip" : "51.91.152.238", "domain" : "aquasuper.in", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1390", "maxsql" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "aquasuper", "plan" : "skystechnology_skystech_premium_ornests", "owner" : "skystechnology", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 25361, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "skystechnologyllp@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "25 Feb 12 23:55", "unix_startdate" : 1739384701 }, { "domain" : "israel-visacheck.com", "ip" : "51.91.152.238", "diskused" : "66M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "plan" : "apkquest_512mb", "user" : "israelvisacheck", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "2864", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "inodesused" : 548, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/usr/local/cpanel/bin/noshell", "suspendtime" : 0, "owner" : "apkquest", "unix_startdate" : 1776960446, "child_nodes" : [], "startdate" : "26 Apr 23 21:37", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "512M" }, { "child_nodes" : [], "startdate" : "22 Sep 12 00:22", "unix_startdate" : 1662922342, "has_backup" : 0, "disklimit" : "200M", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 1302, "owner" : "websbook", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "jpseletedorg", "plan" : "websbook_Linux_100mb", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1186", "suspendreason" : "not suspended", "diskused" : "28M", "ip" : "51.91.152.238", "domain" : "jpseleted.org.in", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0 }, { "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "rtcfactories.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "287M", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "2", "uid" : "1151", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "10", "max_defer_fail_percentage" : "20", "ipv6" : [], "user" : "factoriesrtc", "plan" : "websbook_linux_2000mb", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 2964, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "10", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "10", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "has_backup" : 0, "disklimit" : "2000M", "startdate" : "24 Jul 20 12:58", "child_nodes" : [], "unix_startdate" : 1721460508 }, { "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "10", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2621", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "hhtechsolution_H_Adv", "user" : "iconiceagletrans", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "36M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "iconiceagletransforce.com", "disklimit" : "1500M", "has_backup" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "unix_startdate" : 1650279830, "startdate" : "22 Apr 18 16:33", "child_nodes" : [], "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 578 }, { "unix_startdate" : 1756185937, "child_nodes" : [], "startdate" : "25 Aug 26 10:55", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 43343, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "plan" : "winggolearning_raj", "user" : "savioranimalwelf", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "2427", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "savioranimalwelfare.org", "ip" : "51.254.16.113", "diskused" : "1350M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 2872, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0, "unix_startdate" : 1746039153, "child_nodes" : [], "startdate" : "25 May 01 00:22", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "89M", "suspendreason" : "not suspended", "domain" : "sbfgpgcollege.org.in", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "collsbfgpgorg", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxsql" : "1", "uid" : "1125", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter" }, { "outgoing_mail_hold" : 0, "partition" : "home", "email" : "togolais2008@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1625316122, "startdate" : "21 Jul 03 18:12", "child_nodes" : [], "owner" : "root", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 5350, "max_email_per_hour" : "25", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "100", "ipv6" : [], "maxsql" : "unlimited", "uid" : "1010", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "RED33RESELLER", "user" : "otiyahos", "maxaddons" : "unlimited", "maxparked" : "unlimited", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "155M", "suspendreason" : "not suspended", "domain" : "otiyahosting.me", "ip" : "51.91.152.238" }, { "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2271", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "hindutrust", "plan" : "winggolearning_raj", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1110M", "ip" : "51.254.16.113", "domain" : "hindutrust.in", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "25 Apr 22 13:00", "child_nodes" : [], "unix_startdate" : 1745307009, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 46487 }, { "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "555M", "ip" : "51.254.16.113", "domain" : "suyashshri.com", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2752", "maxsql" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "suyashshri", "plan" : "winggolearning_raj", "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 13957, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "26 Jan 21 18:28", "child_nodes" : [], "unix_startdate" : 1769000284 }, { "suspendreason" : "not suspended", "diskused" : "44M", "ip" : "51.91.152.238", "domain" : "diamondhealth.in", "maxaddons" : "0", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "diamondhealth", "plan" : "royaldiagnosticc_Unlimited plan", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1467", "maxsql" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 1402, "owner" : "royaldiagnosticc", "suspendtime" : 0, "startdate" : "24 Jan 09 22:07", "child_nodes" : [], "unix_startdate" : 1704818261, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited" }, { "backup" : 1, "outgoing_mail_suspended" : 1, "user" : "yoto2mairie", "plan" : "otiyahos_ECO", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "uid" : "1047", "maxsql" : "20", "theme" : "jupiter", "suspendreason" : "Renouvellement non effectué ", "diskused" : "600M", "domain" : "yoto2.mairie.tg", "ip" : "51.91.152.238", "maxaddons" : "10", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "child_nodes" : [], "startdate" : "23 Oct 25 18:51", "unix_startdate" : 1698240069, "maxlst" : "unlimited", "email" : "agenceotiya@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home", "disklimit" : "100000M", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 1, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 12551, "max_email_per_hour" : "25", "owner" : "otiyahos", "suspendtime" : 1729362726 }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 42715, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1736866681, "child_nodes" : [], "startdate" : "25 Jan 14 20:28", "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "diskused" : "980M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "janjeewankayakalpfoundation.org", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "janjeewankaya", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2293", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited" }, { "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1255", "maxsql" : "2", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "user" : "redeaglepublicsc", "plan" : "websbook_1000 MB Linux", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "redeaglepublicschool.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "116M", "maxsub" : "3", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "1", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "has_backup" : 0, "disklimit" : "1000M", "startdate" : "16 Oct 03 01:18", "child_nodes" : [], "unix_startdate" : 1475437712, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 1953, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "1344", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "yuvaayurvedic", "plan" : "websbook_linux_500mb", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "71M", "ip" : "51.91.152.238", "domain" : "yuvaayurvedic.com", "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "child_nodes" : [], "startdate" : "18 Feb 22 13:56", "unix_startdate" : 1519287992, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 883 }, { "plan" : "websbook_1000 MB Linux", "user" : "karmahc", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "1550", "maxsql" : "2", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 0, "max_defer_fail_percentage" : "20", "ipv6" : [], "domain" : "karmahc.online", "ip" : "51.91.152.238", "diskused" : "388M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "unix_startdate" : 1748329923, "startdate" : "25 May 27 12:42", "child_nodes" : [], "maxsub" : "3", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "1", "has_backup" : 0, "disklimit" : "1000M", "inodesused" : 14220, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook" }, { "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2440", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "winggolearning_raj", "user" : "shantifoundation", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "shantifoundations.in", "diskused" : "880M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1734675025, "child_nodes" : [], "startdate" : "24 Dec 20 11:40", "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 37103, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "maxsql" : "unlimited", "uid" : "2861", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "plan" : "winggolearning_raj", "user" : "progressiveindia", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "progressiveindia.co.in", "ip" : "51.254.16.113", "diskused" : "1476M", "suspendreason" : "not suspended", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "unix_startdate" : 1776857847, "child_nodes" : [], "startdate" : "26 Apr 22 17:07", "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 68533, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 66865, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "26 Mar 24 13:55", "child_nodes" : [], "unix_startdate" : 1774340706, "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1292M", "ip" : "51.254.16.113", "domain" : "bmys.in", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2824", "maxsql" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "bmys", "plan" : "winggolearning_raj" }, { "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1768804870, "startdate" : "26 Jan 19 12:11", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 68159, "max_email_per_hour" : "25", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2749", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "sarvlokhitcharit", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "860M", "suspendreason" : "not suspended", "domain" : "sarvlokhitcharitabletrust.in", "ip" : "51.254.16.113" }, { "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1271", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "sainathiti", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "25M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "sainathiti.in", "disklimit" : "500M", "has_backup" : 0, "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "unix_startdate" : 1599659813, "child_nodes" : [], "startdate" : "20 Sep 09 19:26", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 718 }, { "unix_startdate" : 1692028482, "startdate" : "23 Aug 14 21:24", "child_nodes" : [], "maxsub" : "3", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "1", "disklimit" : "1000M", "has_backup" : 0, "inodesused" : 6459, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "plan" : "websbook_1000 MB Linux", "user" : "mbdcentre", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "1209", "maxsql" : "2", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "domain" : "mbdcentre.in", "ip" : "51.91.152.238", "diskused" : "274M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0" }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 20178, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "child_nodes" : [], "startdate" : "25 Nov 17 12:04", "unix_startdate" : 1763361293, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "clinicwebsite.online", "suspendreason" : "not suspended", "diskused" : "1463M", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2565", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "user" : "clinicwebsite", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "diskused" : "1003M", "suspendreason" : "not suspended", "domain" : "wellnessfoundation.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "wellness", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2507", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 35520, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1726834643, "child_nodes" : [], "startdate" : "24 Sep 20 17:47", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 248920, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1753714174, "startdate" : "25 Jul 28 20:19", "child_nodes" : [], "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "3546M", "suspendreason" : "not suspended", "domain" : "ngosoftware.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "ngosoftware", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2358", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter" }, { "max_email_per_hour" : "unlimited", "inodesused" : 1257, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "child_nodes" : [], "startdate" : "15 Feb 12 15:59", "unix_startdate" : 1423736972, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "has_backup" : 0, "disklimit" : "200M", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "ip" : "51.91.152.238", "domain" : "shrideviprasadmahavidyalaya.com", "suspendreason" : "not suspended", "diskused" : "65M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "shrideviprasadma", "plan" : "websbook_Linux_100mb", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "maxsql" : "1", "uid" : "1289", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5" }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 38822, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1724226240, "child_nodes" : [], "startdate" : "24 Aug 21 13:14", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "navgyanfoundation.in", "diskused" : "1018M", "suspendreason" : "not suspended", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2351", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "winggolearning_raj", "user" : "navgyan", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "mewalalsinghpgcollege.org", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "35M", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1214", "maxsql" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "user" : "mewalal", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 682, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "disklimit" : "500M", "has_backup" : 0, "child_nodes" : [], "startdate" : "23 Mar 02 23:11", "unix_startdate" : 1677778883 }, { "ip" : "51.91.152.238", "domain" : "okeystudios.com", "suspendreason" : "not suspended", "diskused" : "3353M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "10", "maxparked" : "0", "user" : "okeystudios", "plan" : "otiyahos_ECO", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "maxsql" : "20", "uid" : "1066", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 75092, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "otiyahos", "child_nodes" : [], "startdate" : "25 Jan 13 21:39", "unix_startdate" : 1736784598, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "100000M", "maxlst" : "unlimited", "email" : "agenceotiya@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home" }, { "inodesused" : 154529, "max_email_per_hour" : "25", "shell" : "/usr/local/cpanel/bin/noshell", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "otiyahos", "child_nodes" : [], "startdate" : "26 May 01 18:59", "unix_startdate" : 1777642153, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "togolais2008@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "domain" : "gapola.tg", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "25192M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "gapola", "plan" : "otiyahos_express", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2875", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "*unknown*" }, { "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 845, "max_email_per_hour" : "25", "maxlst" : "0", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "21 Apr 10 10:07", "unix_startdate" : 1618029467, "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "35M", "domain" : "crjh.in", "ip" : "51.91.152.238", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1129", "maxsql" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "crjhsanj", "plan" : "websbook_linux_500mb" }, { "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxsql" : "1", "uid" : "2596", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "hhtechsolution_H_Basic", "user" : "asabs", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "99M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "asabs.in", "disklimit" : "250M", "has_backup" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "unix_startdate" : 1687450166, "startdate" : "23 Jun 22 21:39", "child_nodes" : [], "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 1621 }, { "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 320, "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "child_nodes" : [], "startdate" : "19 Nov 05 11:12", "unix_startdate" : 1572932552, "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "8M", "ip" : "51.91.152.238", "domain" : "vaishnavidegreecollege.org", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1326", "maxsql" : "1", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "vaisnavidegreec", "plan" : "websbook_linux_500mb" }, { "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "disklimit" : "250M", "has_backup" : 0, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "24 Aug 12 11:49", "child_nodes" : [], "unix_startdate" : 1723443555, "owner" : "hhtechsolution", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 599, "max_email_per_hour" : "25", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "2656", "maxsql" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "sawantnathpacker", "plan" : "hhtechsolution_H_Basic", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "50M", "domain" : "sawantnathpackers.com", "ip" : "51.91.152.238" }, { "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 6830, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "10", "disklimit" : "2000M", "has_backup" : 0, "maxlst" : "10", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "startdate" : "15 Jun 08 12:01", "child_nodes" : [], "unix_startdate" : 1433745119, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "mdssansthan.org.in", "suspendreason" : "not suspended", "diskused" : "347M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "2", "uid" : "1213", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "10", "legacy_backup" : 1, "user" : "mdssansthan", "plan" : "websbook_linux_2000mb", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1772171397, "startdate" : "26 Feb 27 11:19", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 67076, "max_email_per_hour" : "25", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2794", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "krishnasachkhand", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "851M", "suspendreason" : "not suspended", "domain" : "krishnasachkhandfoundation.in", "ip" : "51.254.16.113" }, { "max_email_per_hour" : "25", "inodesused" : 10125, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "skystechnology", "unix_startdate" : 1751598424, "child_nodes" : [], "startdate" : "25 Jul 04 08:37", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "email" : "skystechnologyllp@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "ip" : "51.91.152.238", "domain" : "nsdigitalecomm.com", "diskused" : "244M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "5", "maxaddons" : "5", "plan" : "skystechnology_skystech_premium_ornests", "user" : "nsdigitalecomm", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1968", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "unlimited" }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 65156, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "child_nodes" : [], "startdate" : "25 Nov 19 17:44", "unix_startdate" : 1763554466, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "secf.co.in", "suspendreason" : "not suspended", "diskused" : "937M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2568", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "user" : "secf", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 45925, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1746544659, "startdate" : "25 May 06 20:47", "child_nodes" : [], "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "diskused" : "1020M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "sarthakwelfaresociety.in", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "sarthakwelfare", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2421", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited" }, { "ip" : "51.254.16.113", "domain" : "caresupportfoundation.in", "diskused" : "926M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "plan" : "winggolearning_raj", "user" : "caresupportfound", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "2213", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 44724, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1750665029, "startdate" : "25 Jun 23 13:20", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited" }, { "domain" : "sethsanwariyaasewawelfare.in", "ip" : "51.254.16.113", "diskused" : "848M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "plan" : "winggolearning_raj", "user" : "sethsanwariyaase", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "2697", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "inodesused" : 58948, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1765456574, "child_nodes" : [], "startdate" : "25 Dec 11 18:06", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited" }, { "diskused" : "221M", "suspendreason" : "not suspended", "domain" : "ggisbel.in", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "default", "user" : "ggisbelggisbel", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxsql" : "unlimited", "uid" : "1347", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 13133, "max_email_per_hour" : "unlimited", "owner" : "niipmcom", "suspendtime" : 0, "unix_startdate" : 1747115329, "startdate" : "25 May 13 11:18", "child_nodes" : [], "partition" : "home", "email" : "admin@ggisbel.in", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "maxsql" : "1", "uid" : "1328", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500mb", "user" : "vatsalyasocietyo", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "114M", "suspendreason" : "not suspended", "domain" : "vatsalyasociety.org.in", "ip" : "51.91.152.238", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1621247789, "child_nodes" : [], "startdate" : "21 May 17 16:06", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1480, "max_email_per_hour" : "25" }, { "theme" : "jupiter", "maxsql" : "10", "uid" : "1360", "maxftp" : "5", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "10", "ipv6" : [], "maxpop" : "15", "legacy_backup" : 1, "plan" : "apkquest_250mb", "user" : "indiaforall", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "indiaforall.in", "diskused" : "80M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "10", "has_backup" : 0, "disklimit" : "250M", "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "5", "unix_startdate" : 1727748643, "child_nodes" : [], "startdate" : "24 Oct 01 07:40", "suspendtime" : 0, "owner" : "apkquest", "max_email_per_hour" : "50", "inodesused" : 936, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2858", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "besttechbalvikas", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1311M", "domain" : "besttechbalvikas.org", "ip" : "51.254.16.113", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "26 Apr 16 12:57", "unix_startdate" : 1776324458, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 67998, "max_email_per_hour" : "25" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "lhentreprise", "plan" : "otiyahos_ECO", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxftp" : "10", "max_emailacct_quota" : "unlimited", "maxsql" : "20", "uid" : "1026", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "1323M", "domain" : "lhentreprise.com", "ip" : "51.91.152.238", "maxaddons" : "10", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "child_nodes" : [], "startdate" : "21 Aug 30 13:30", "unix_startdate" : 1630310412, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "togolais2008@gmail.com", "partition" : "home", "has_backup" : 0, "disklimit" : "100000M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 16135, "max_email_per_hour" : "25", "owner" : "otiyahos", "suspendtime" : 0 }, { "diskused" : "1198M", "suspendreason" : "not suspended", "domain" : "bharatipublicwelfaretrust.org", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "bharatipublic", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2201", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 67152, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1735741527, "startdate" : "25 Jan 01 19:55", "child_nodes" : [], "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "has_backup" : 0, "disklimit" : "unlimited", "email" : "rvsingh7843@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1639041201, "startdate" : "21 Dec 09 14:43", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 10841, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2493", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "default", "user" : "veethika", "maxparked" : "0", "maxaddons" : "5", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "681M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "veethika.co.in" }, { "suspendtime" : 0, "owner" : "otiyahos", "max_email_per_hour" : "25", "inodesused" : 46790, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "100000M", "has_backup" : 0, "maxlst" : "unlimited", "email" : "agenceotiya@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "child_nodes" : [], "startdate" : "25 Sep 18 22:06", "unix_startdate" : 1758213372, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "10", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "foddet.tg", "suspendreason" : "not suspended", "diskused" : "4967M", "theme" : "jupiter", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "maxsql" : "20", "uid" : "1990", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "user" : "foddet", "plan" : "otiyahos_ECO", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "skystechnology_skystech_premium_ornests", "user" : "diptijewls", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1976", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "diskused" : "215M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "diptijewls.in", "maxaddons" : "5", "maxparked" : "5", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1753607416, "startdate" : "25 Jul 27 14:40", "child_nodes" : [], "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "skystechnologyllp@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 9334, "owner" : "skystechnology", "suspendtime" : 0 }, { "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 43544, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "26 Apr 24 13:51", "unix_startdate" : 1777018872, "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "941M", "ip" : "51.254.16.113", "domain" : "pbvs.in", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2866", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "pbvs", "plan" : "winggolearning_raj" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 27396, "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "24 May 13 15:42", "child_nodes" : [], "unix_startdate" : 1715595138, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "suspendreason" : "not suspended", "diskused" : "1036M", "ip" : "51.254.16.113", "domain" : "dharmarthramasociety.in", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "dharmarthrama", "plan" : "winggolearning_raj", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2235" }, { "theme" : "jupiter", "uid" : "2630", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "plan" : "hhtechsolution_H_Basic", "user" : "kalajeevi", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "kalajeevi.com", "diskused" : "132M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "disklimit" : "250M", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1692786340, "startdate" : "23 Aug 23 15:55", "child_nodes" : [], "suspendtime" : 0, "owner" : "hhtechsolution", "max_email_per_hour" : "25", "inodesused" : 917, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "mezbaanre", "plan" : "default", "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2130", "suspendreason" : "not suspended", "diskused" : "2305M", "ip" : "51.91.152.238", "domain" : "mezbaanrestaurant.in", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "child_nodes" : [], "startdate" : "23 Jun 19 18:42", "unix_startdate" : 1687180364, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "topweblogic@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "*unknown*", "inodesused" : 110463, "owner" : "topweblogic", "suspendtime" : 0 }, { "suspendtime" : 0, "owner" : "topweblogic", "inodesused" : 67832, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "25", "outgoing_mail_hold" : 0, "email" : "topweblogic@gmail.com", "partition" : "home2", "disklimit" : "3000M", "has_backup" : 0, "startdate" : "21 Dec 03 22:12", "child_nodes" : [], "unix_startdate" : 1638549729, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "mykarsol.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "2460M", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "10", "uid" : "2131", "theme" : "jupiter", "maxpop" : "10", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "user" : "mykarsol", "plan" : "topweblogic_Silver Package_mykarsol_mykarsol", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "startdate" : "26 Mar 12 17:09", "child_nodes" : [], "unix_startdate" : 1773315578, "maxlst" : "25", "email" : "hetshukla@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "2000M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 21844, "max_email_per_hour" : "25", "owner" : "topweblogic", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "rikni", "plan" : "default", "maxpop" : "2", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "5", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "maxsql" : "1", "uid" : "2809", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "609M", "domain" : "nikir.com", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0 }, { "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 1824, "disklimit" : "500M", "has_backup" : 0, "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "unix_startdate" : 1647969146, "child_nodes" : [], "startdate" : "22 Mar 22 22:42", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "45M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "tomch.org", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1324", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500mb", "user" : "tomch" }, { "child_nodes" : [], "startdate" : "24 May 12 21:42", "unix_startdate" : 1715530323, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "250M", "inodesused" : 991, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "hhtechsolution", "user" : "layalibahrain", "plan" : "hhtechsolution_H_Basic", "outgoing_mail_suspended" : 1, "backup" : 1, "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "2633", "maxsql" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "layalibahrain.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "78M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0" }, { "ip" : "51.91.152.238", "domain" : "fortuneinn.in", "diskused" : "139M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "plan" : "hhtechsolution_H_Basic", "user" : "fortuneinn", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxsql" : "1", "uid" : "2610", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "max_email_per_hour" : "25", "inodesused" : 1101, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "hhtechsolution", "unix_startdate" : 1624011234, "child_nodes" : [], "startdate" : "21 Jun 18 15:43", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "has_backup" : 0, "disklimit" : "250M", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited" }, { "suspendtime" : 0, "owner" : "otiyahos", "max_email_per_hour" : "25", "inodesused" : 31310, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "100000M", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "agenceotiya@gmail.com", "startdate" : "25 Feb 26 21:44", "child_nodes" : [], "unix_startdate" : 1740586452, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "10", "ip" : "51.91.152.238", "domain" : "radiolafamille.tg", "suspendreason" : "not suspended", "diskused" : "2879M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "uid" : "1067", "maxsql" : "20", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "user" : "radiolafamille", "plan" : "otiyahos_ECO", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1530", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "Red91Solid", "user" : "climaxlo", "backup" : 1, "outgoing_mail_suspended" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "climaxloan.com", "diskused" : "1451M", "suspendreason" : "Overdue on Payment", "inodeslimit" : "unlimited", "suspended" : 1, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "10000M", "email" : "v42190685@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1716894541, "child_nodes" : [], "startdate" : "24 May 28 16:39", "suspendtime" : 1748500216, "owner" : "root", "max_email_per_hour" : "unlimited", "inodesused" : 34854, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 63578, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "child_nodes" : [], "startdate" : "25 Jun 19 18:13", "unix_startdate" : 1750337034, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "radhaswamiorg.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1429M", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2386", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "radhaswamiorg", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "shell" : "/usr/local/cpanel/bin/noshell", "mailbox_format" : "maildir", "inodesused" : 161, "max_email_per_hour" : "25", "owner" : "otiyahos", "suspendtime" : 0, "child_nodes" : [], "startdate" : "26 May 04 12:47", "unix_startdate" : 1777879050, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "agenceotiya@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "100000M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "2M", "domain" : "sprintradio.tg", "ip" : "51.91.152.238", "maxaddons" : "10", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "sprintradio", "plan" : "otiyahos_ECO", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "uid" : "2883", "maxsql" : "20", "theme" : "jupiter" }, { "unix_startdate" : 1777029125, "child_nodes" : [], "startdate" : "26 Apr 24 16:42", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 67339, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "plan" : "winggolearning_raj", "user" : "kpeducationalngo", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "2867", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "kpeducationalngo.in", "ip" : "51.254.16.113", "diskused" : "1282M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1" }, { "owner" : "thesunda", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 38445, "disklimit" : "4096M", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "sacretcode@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "23 Jun 21 20:43", "child_nodes" : [], "unix_startdate" : 1687360392, "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "2412M", "ip" : "51.91.152.238", "domain" : "metalartindia.com", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1419", "maxsql" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "metalartindia", "plan" : "thesunda_4gbcinemehta" }, { "suspendtime" : 0, "owner" : "hhtechsolution", "max_email_per_hour" : "25", "inodesused" : 1307, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "disklimit" : "250M", "has_backup" : 0, "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1672917466, "child_nodes" : [], "startdate" : "23 Jan 05 16:47", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "oceansschool.org", "diskused" : "221M", "suspendreason" : "not suspended", "theme" : "jupiter", "maxsql" : "1", "uid" : "2639", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "plan" : "hhtechsolution_H_Basic", "user" : "oceansschool", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "diskused" : "15688M", "suspendreason" : "not suspended", "domain" : "dizisolutions.in", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "Red11Backup", "user" : "dizisolu", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "10", "maxsql" : "20", "uid" : "1008", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 215038, "max_email_per_hour" : "25", "owner" : "root", "suspendtime" : 0, "unix_startdate" : 1665338597, "child_nodes" : [], "startdate" : "22 Oct 09 23:33", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "dizisolutionshyd@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "max_email_per_hour" : "25", "inodesused" : 23511, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1762940357, "child_nodes" : [], "startdate" : "25 Nov 12 15:09", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "*unknown*", "maxlst" : "unlimited", "ip" : "51.254.16.113", "domain" : "ngosoftware.online", "diskused" : "591M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "plan" : "winggolearning_raj", "user" : "digitalngosoftwa", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "2561", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited" }, { "max_email_per_hour" : "25", "inodesused" : 9123, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "thesunda", "child_nodes" : [], "startdate" : "24 Jun 13 22:49", "unix_startdate" : 1718299149, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "disklimit" : "1024M", "has_backup" : 0, "maxlst" : "0", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "sacretcode@gmail.com", "ip" : "51.91.152.238", "domain" : "eaglesecureservices.com", "suspendreason" : "not suspended", "diskused" : "283M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "eaglesecureservi", "plan" : "thesunda_cine1024", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "5", "uid" : "1406", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "3" }, { "maxsub" : "unlimited", "suspended" : 1, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "ekdigimedia@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "child_nodes" : [], "startdate" : "25 Dec 09 15:23", "unix_startdate" : 1765274031, "suspendtime" : 1765347325, "owner" : "root", "inodesused" : 3576, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2692", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "user" : "apexxnut", "plan" : "RED91SSD", "backup" : 1, "outgoing_mail_suspended" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "unlimited", "maxaddons" : "0", "domain" : "apexxnutrition.co.in", "ip" : "51.91.152.238", "suspendreason" : "moved to server56", "diskused" : "600M" }, { "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2720", "maxsql" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "dhanwantari", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "783M", "domain" : "divinedhanwantarihospital.in", "ip" : "51.254.16.113", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "25 Dec 27 16:04", "unix_startdate" : 1766831640, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 23772, "max_email_per_hour" : "25" }, { "inodesused" : 133110, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "otiyahos", "unix_startdate" : 1626853167, "child_nodes" : [], "startdate" : "21 Jul 21 13:09", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "togolais2008@gmail.com", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "domain" : "odayey.com", "ip" : "51.91.152.238", "diskused" : "30336M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "unlimited", "maxparked" : "unlimited", "plan" : "otiyahos_Pack-Webmaster", "user" : "odayey", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "1030", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited" }, { "plan" : "hhtechsolution_H_Adv", "user" : "saftco", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxsql" : "1", "uid" : "2652", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "10", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "saft.co.in", "diskused" : "404M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "unix_startdate" : 1691648746, "child_nodes" : [], "startdate" : "23 Aug 10 11:55", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "disklimit" : "1500M", "has_backup" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "1", "max_email_per_hour" : "25", "inodesused" : 3092, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "hhtechsolution" }, { "unix_startdate" : 1727823550, "child_nodes" : [], "startdate" : "24 Oct 02 04:29", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "1024M", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 34658, "max_email_per_hour" : "unlimited", "owner" : "apkquest", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "apkquest_1gb", "user" : "speech2text", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "uid" : "1381", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "diskused" : "451M", "suspendreason" : "not suspended", "domain" : "speech2text.in", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "unix_startdate" : 1706692884, "startdate" : "24 Jan 31 14:51", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 1, "maxsub" : "unlimited", "disklimit" : "100000M", "has_backup" : 0, "email" : "togolais2008@gmail.com", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 28326, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 1737362825, "owner" : "otiyahos", "plan" : "otiyahos_ECO", "user" : "zemradio", "outgoing_mail_suspended" : 1, "backup" : 1, "theme" : "jupiter", "maxsql" : "20", "uid" : "1048", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "zemradio.tg", "diskused" : "4501M", "suspendreason" : "Renouvellement non effectué ", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "10", "maxparked" : "0" }, { "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "861M", "domain" : "rajabariartrust.in", "ip" : "51.254.16.113", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2387", "maxsql" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "rajabariartrust", "plan" : "winggolearning_raj", "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 35249, "max_email_per_hour" : "25", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Dec 09 13:21", "unix_startdate" : 1733730717 }, { "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 668, "max_email_per_hour" : "25", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "250M", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1673069549, "child_nodes" : [], "startdate" : "23 Jan 07 11:02", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "31M", "suspendreason" : "not suspended", "domain" : "rowaterpurifierservice.in", "ip" : "51.91.152.238", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "1", "uid" : "2648", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "hhtechsolution_H_Basic", "user" : "rowaterpurifiers" }, { "suspendreason" : "The domain dtdccargomoversandpackers[.]org is hosted on the above IP address, are misleading users by mimicking the official DTDC website and may be involved in fraudulent or phishing activities. ", "diskused" : "73M", "ip" : "51.91.152.238", "domain" : "dtdccargomoversandpackers.org", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 1, "outgoing_mail_suspended" : 1, "backup" : 1, "user" : "moversadtdccargo", "plan" : "hhtechsolution_H_Adv", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "10", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "2636", "maxsql" : "1", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 827, "owner" : "hhtechsolution", "suspendtime" : 1767933610, "child_nodes" : [], "startdate" : "25 Jul 09 22:32", "unix_startdate" : 1752080535, "has_backup" : 0, "disklimit" : "1500M", "maxlst" : "1", "email" : "*unknown*", "partition" : "home2", "outgoing_mail_hold" : 0, "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "5" }, { "owner" : "apkquest", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 101039, "max_email_per_hour" : "unlimited", "email" : "shivm2177@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "2048M", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1730634465, "startdate" : "24 Nov 03 17:17", "child_nodes" : [], "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1481M", "suspendreason" : "not suspended", "domain" : "lawpad.in", "ip" : "51.91.152.238", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "uid" : "1367", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "apkquest_1gb", "user" : "lawpad" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "balramma", "plan" : "websbook_Linux_100mb", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "maxsql" : "1", "uid" : "1105", "suspendreason" : "not suspended", "diskused" : "61M", "ip" : "51.91.152.238", "domain" : "balrammahavidyalayabed.org", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "startdate" : "13 Mar 01 13:59", "child_nodes" : [], "unix_startdate" : 1362126562, "has_backup" : 0, "disklimit" : "200M", "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 2269, "owner" : "websbook", "suspendtime" : 0 }, { "ip" : "51.91.152.238", "domain" : "radiosaintetherese.com", "diskused" : "39795M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "10", "plan" : "otiyahos_ECO", "user" : "radiosaintethere", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1036", "maxsql" : "20", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 104457, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "otiyahos", "unix_startdate" : 1649316527, "startdate" : "22 Apr 07 12:58", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "100000M", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "togolais2008@gmail.com", "maxlst" : "unlimited" }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 55652, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "unix_startdate" : 1745922177, "child_nodes" : [], "startdate" : "25 Apr 29 15:52", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "tudufoundation.org", "diskused" : "1359M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "2484", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "winggolearning_raj", "user" : "tudufoundation", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "domain" : "humanityambulance.com", "ip" : "51.91.152.238", "diskused" : "294M", "suspendreason" : "not suspended", "uid" : "2619", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "30", "plan" : "hhtechsolution_H_Basic", "user" : "humanityambulanc", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 9, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "250M", "has_backup" : 0, "unix_startdate" : 1725033838, "startdate" : "24 Aug 30 21:33", "child_nodes" : [] }, { "max_email_per_hour" : "unlimited", "inodesused" : 9164, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "royaldiagnosticc", "child_nodes" : [], "startdate" : "24 Oct 02 17:41", "unix_startdate" : 1727871068, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "*unknown*", "outgoing_mail_hold" : 0, "ip" : "51.91.152.238", "domain" : "zeolite.in", "suspendreason" : "not suspended", "diskused" : "245M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "zeolite", "plan" : "royaldiagnosticc_Unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1503", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 6324, "max_email_per_hour" : "25", "owner" : "hhtechsolution", "suspendtime" : 0, "unix_startdate" : 1615180469, "startdate" : "21 Mar 08 10:44", "child_nodes" : [], "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "250M", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "119M", "suspendreason" : "not suspended", "domain" : "snehamathil.com", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "hhtechsolution_H_Basic", "user" : "snehamathil", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2662", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter" }, { "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2578", "maxsql" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "navasrijanskilld", "plan" : "winggolearning_raj", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "878M", "domain" : "navasrijanskilldevelopmentfoundation.in", "ip" : "51.254.16.113", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "25 Nov 27 17:35", "unix_startdate" : 1764245107, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 67378, "max_email_per_hour" : "25" }, { "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "uid" : "1170", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "ictcomputercolle", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "59M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "ictcomputercollege.in", "disklimit" : "500M", "has_backup" : 0, "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "unix_startdate" : 1670117726, "startdate" : "22 Dec 04 07:05", "child_nodes" : [], "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 2284 }, { "diskused" : "47M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "srimanjunathatravels.com", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "hhtechsolution_H_Basic", "user" : "srimanjunathatra", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "uid" : "2665", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 631, "owner" : "hhtechsolution", "suspendtime" : 0, "unix_startdate" : 1673935266, "child_nodes" : [], "startdate" : "23 Jan 17 11:31", "disklimit" : "250M", "has_backup" : 0, "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1" }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 43042, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "unix_startdate" : 1758794517, "startdate" : "25 Sep 25 15:31", "child_nodes" : [], "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "shivshaktiresearchfoundation.co.in", "diskused" : "897M", "suspendreason" : "not suspended", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2263", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "winggolearning_raj", "user" : "haktiresearch", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "domain" : "dharmukalyansmiti.in", "ip" : "51.254.16.113", "diskused" : "1013M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "plan" : "winggolearning_raj", "user" : "dharmukalyansmit", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "unlimited", "uid" : "2555", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "inodesused" : 43419, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1762348048, "child_nodes" : [], "startdate" : "25 Nov 05 18:37", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited" }, { "plan" : "winggolearning_raj", "user" : "dharanafoundatio", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "unlimited", "uid" : "2734", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "dharanafoundation.org", "ip" : "51.254.16.113", "diskused" : "942M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "unix_startdate" : 1767762753, "child_nodes" : [], "startdate" : "26 Jan 07 10:42", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 45089, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 24504, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1735309142, "startdate" : "24 Dec 27 19:49", "child_nodes" : [], "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "513M", "suspendreason" : "not suspended", "domain" : "life2zone.com", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "life2zone", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2315", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter" }, { "startdate" : "25 Mar 31 11:59", "child_nodes" : [], "unix_startdate" : 1743402585, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "max_email_per_hour" : "25", "inodesused" : 45710, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "user" : "bhrcrimecontrol", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2205", "maxsql" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.254.16.113", "domain" : "bhrcrimecontrol.in", "suspendreason" : "not suspended", "diskused" : "1007M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1" }, { "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1504M", "suspendreason" : "not suspended", "domain" : "rotifoundation.org.in", "ip" : "51.254.16.113", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2398", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "rotifoundation", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 61046, "max_email_per_hour" : "25", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1726903031, "startdate" : "24 Sep 21 12:47", "child_nodes" : [] }, { "suspendtime" : 0, "owner" : "topweblogic", "max_email_per_hour" : "25", "inodesused" : 21739, "shell" : "/usr/local/cpanel/bin/noshell", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "has_backup" : 0, "disklimit" : "1000M", "maxlst" : "25", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "startdate" : "20 Aug 04 16:12", "child_nodes" : [], "unix_startdate" : 1596537751, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "hindupriestaum.com", "suspendreason" : "not suspended", "diskused" : "424M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "2871", "maxsql" : "2", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "10", "legacy_backup" : 1, "user" : "hindupriestaum", "plan" : "topweblogic_Silver Package", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "togolais2008@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home", "disklimit" : "100000M", "has_backup" : 0, "child_nodes" : [], "startdate" : "23 Jun 21 22:41", "unix_startdate" : 1687367486, "suspendtime" : 0, "owner" : "otiyahos", "inodesused" : 120838, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "maxsql" : "20", "uid" : "1027", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "user" : "matinlibre", "plan" : "otiyahos_ECO", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "10", "maxparked" : "0", "domain" : "matinlibre.bf", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "14694M" }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "domain" : "diahealth.in", "ip" : "51.91.152.238", "diskused" : "143M", "suspendreason" : "not suspended", "uid" : "2603", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "10", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "hhtechsolution_H_Adv", "user" : "diahealth", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 1874, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "maxlst" : "1", "disklimit" : "1500M", "has_backup" : 0, "unix_startdate" : 1639472596, "startdate" : "21 Dec 14 14:33", "child_nodes" : [] }, { "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1309M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "hwct.in", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2820", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "hwc", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 68293, "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1773916338, "startdate" : "26 Mar 19 16:02", "child_nodes" : [] }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_1000 MB Linux", "user" : "spmgdcbhadohiorg", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1311", "maxsql" : "2", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "diskused" : "398M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "spmgdcbhadohi.org.in", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1512659322, "startdate" : "17 Dec 07 20:38", "child_nodes" : [], "has_backup" : 0, "disklimit" : "1000M", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "3", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 2501, "owner" : "websbook", "suspendtime" : 0 }, { "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "kewlapati.org.in", "suspendreason" : "not suspended", "diskused" : "300M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "2", "uid" : "1192", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "10", "user" : "kewlapatiorg", "plan" : "websbook_linux_2000mb", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 2288, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "10", "disklimit" : "2000M", "has_backup" : 0, "maxlst" : "10", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "child_nodes" : [], "startdate" : "21 Aug 11 13:54", "unix_startdate" : 1628670286 }, { "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxsql" : "unlimited", "uid" : "1445", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 1, "backup" : 1, "plan" : "RED31RESELLER", "user" : "dnsscom", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "637M", "suspendreason" : "Overdue on Payment", "domain" : "dnss4.com", "ip" : "51.91.152.238", "email" : "sachin@crazyhost.in", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 1, "unix_startdate" : 1676641944, "child_nodes" : [], "startdate" : "23 Feb 17 19:22", "owner" : "root", "suspendtime" : 1765953020, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 36633, "max_email_per_hour" : "unlimited" }, { "child_nodes" : [], "startdate" : "22 Jun 14 03:04", "unix_startdate" : 1655156060, "maxlst" : "0", "partition" : "home2", "email" : "sacretcode@gmail.com", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "1024M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 6773, "max_email_per_hour" : "25", "owner" : "thesunda", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "prasadaorg", "plan" : "thesunda_cine1024", "maxpop" : "3", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "5", "uid" : "1425", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "166M", "domain" : "prasada.org.in", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0 }, { "domain" : "mediatech.org.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "635M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "user" : "mediatech", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2333", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "inodesused" : 31055, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "child_nodes" : [], "startdate" : "25 Sep 17 16:46", "unix_startdate" : 1758107770, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited" }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "sitashiromanidegreecollege.com", "suspendreason" : "not suspended", "diskused" : "34M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "maxsql" : "1", "uid" : "1295", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "user" : "sitashir", "plan" : "websbook_Linux_100mb", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "unlimited", "inodesused" : 902, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "disklimit" : "200M", "has_backup" : 0, "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "child_nodes" : [], "startdate" : "13 Mar 02 20:32", "unix_startdate" : 1362236559 }, { "unix_startdate" : 1749448942, "startdate" : "25 Jun 09 11:32", "child_nodes" : [], "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 47721, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "kalyanmahila", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2307", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "1761M", "suspendreason" : "not suspended", "domain" : "mahilakalyanfoundation.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "suspendtime" : 0, "owner" : "hhtechsolution", "max_email_per_hour" : "25", "inodesused" : 679, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "has_backup" : 0, "disklimit" : "250M", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited", "unix_startdate" : 1686968652, "startdate" : "23 Jun 17 07:54", "child_nodes" : [], "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "iconiceagletransforce.co.in", "diskused" : "33M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "2623", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "plan" : "hhtechsolution_H_Basic", "user" : "indiconiceagle", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "plan" : "root_raj", "user" : "cpsamawa", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "2220", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "domain" : "cpsamawa.com", "ip" : "51.254.16.113", "diskused" : "424M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "5", "maxparked" : "unlimited", "unix_startdate" : 1695910844, "child_nodes" : [], "startdate" : "23 Sep 28 19:50", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "10000M", "inodesused" : 14540, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning" }, { "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "10M", "ip" : "51.91.152.238", "domain" : "goluxdrive.in", "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2856", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "goluxdrive", "plan" : "default", "owner" : "skystechnology", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 300, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "skystechnologyllp@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "26 Apr 15 01:45", "unix_startdate" : 1776197709 }, { "inodesused" : 66815, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1772441380, "child_nodes" : [], "startdate" : "26 Mar 02 14:19", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "domain" : "thearunachalfuturescape.org.in", "ip" : "51.254.16.113", "diskused" : "859M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "plan" : "winggolearning_raj", "user" : "thearunachalfutu", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "2798", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [] }, { "ip" : "51.91.152.238", "domain" : "websitebuy.in", "suspendreason" : "not suspended", "diskused" : "2404M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "10", "maxparked" : "10", "user" : "india", "plan" : "websiteg_Pack1", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "uid" : "1172", "maxsql" : "10", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "10", "max_email_per_hour" : "unlimited", "inodesused" : 54447, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websiteg", "startdate" : "19 Dec 31 19:24", "child_nodes" : [], "unix_startdate" : 1577800463, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "10", "disklimit" : "10000M", "has_backup" : 0, "maxlst" : "10", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0 }, { "unix_startdate" : 1744611554, "child_nodes" : [], "startdate" : "25 Apr 14 11:49", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 44992, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "plan" : "winggolearning_raj", "user" : "parikalppanaa", "outgoing_mail_suspended" : 0, "backup" : 1, "maxsql" : "unlimited", "uid" : "2370", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "parikalppanaa.in", "ip" : "51.254.16.113", "diskused" : "957M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1" }, { "maxsql" : "1", "uid" : "1181", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "plan" : "websbook_linux_500mb", "user" : "jeevanlagan", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "domain" : "jeevanlagan.com", "ip" : "51.91.152.238", "diskused" : "219M", "suspendreason" : "not suspended", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0, "unix_startdate" : 1597297995, "child_nodes" : [], "startdate" : "20 Aug 13 11:23", "suspendtime" : 0, "owner" : "websbook", "inodesused" : 10216, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "inodesused" : 803, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "child_nodes" : [], "startdate" : "15 Jun 20 10:59", "unix_startdate" : 1434778199, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "has_backup" : 0, "disklimit" : "500M", "domain" : "sardarpateliti.co.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "13M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "sardarpatelitico", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1, "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1278", "maxsql" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20" }, { "domain" : "sntlawcollege.org.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "26M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "sntlawcollegeorg", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "2797", "maxsql" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 0, "max_defer_fail_percentage" : "20", "ipv6" : [], "inodesused" : 282, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "child_nodes" : [], "startdate" : "26 Feb 28 12:10", "unix_startdate" : 1772260832, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "partition" : "home2", "email" : "*unknown*", "outgoing_mail_hold" : 0, "disklimit" : "500M", "has_backup" : 0 }, { "unix_startdate" : 1767948111, "child_nodes" : [], "startdate" : "26 Jan 09 14:11", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "max_email_per_hour" : "unlimited", "inodesused" : 83, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "root", "plan" : "default", "user" : "helloishankn", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2739", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "ip" : "51.91.152.238", "domain" : "helloishankn.com", "diskused" : "1M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "unlimited", "maxaddons" : "unlimited" }, { "uid" : "1208", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "websbook_Linux_100mb", "user" : "mayadevigroupofi", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "domain" : "mayadevigroupofinstitutions.org", "ip" : "51.91.152.238", "diskused" : "25M", "suspendreason" : "not suspended", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "has_backup" : 0, "disklimit" : "200M", "unix_startdate" : 1482641782, "child_nodes" : [], "startdate" : "16 Dec 25 10:26", "suspendtime" : 0, "owner" : "websbook", "inodesused" : 722, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "unix_startdate" : 1736942739, "startdate" : "25 Jan 15 17:35", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 8065, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "plan" : "winggolearning_raj", "user" : "thevideonews", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2480", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.254.16.113", "domain" : "thevideonews.in", "diskused" : "332M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1" }, { "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "2591", "maxsql" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "alliedmoverscarg", "plan" : "hhtechsolution_H_Basic", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "139M", "domain" : "alliedmoverscargopackers.com", "ip" : "51.91.152.238", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "has_backup" : 0, "disklimit" : "250M", "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "23 Jul 25 21:50", "unix_startdate" : 1690302045, "owner" : "hhtechsolution", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 5736, "max_email_per_hour" : "25" }, { "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 1626, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "unix_startdate" : 1658642963, "child_nodes" : [], "startdate" : "22 Jul 24 11:39", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "spasdango.org.in", "diskused" : "96M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "1309", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "plan" : "websbook_linux_500mb", "user" : "spasdangoorg", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "inodesused" : 67913, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "26 Apr 16 16:28", "child_nodes" : [], "unix_startdate" : 1776337121, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "domain" : "sathipathifoundation.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1422M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "user" : "sathipathifounda", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2859", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [] }, { "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "samahajan@hotmail.com", "has_backup" : 0, "disklimit" : "10000M", "child_nodes" : [], "startdate" : "24 Sep 19 15:21", "unix_startdate" : 1726739514, "suspendtime" : 0, "owner" : "root", "inodesused" : 12682, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1514", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "user" : "waynauti", "plan" : "Red91Solid", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "waynautic.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "342M" }, { "user" : "vtfoundation", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2502", "maxsql" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.254.16.113", "domain" : "vtfoundation.in", "suspendreason" : "not suspended", "diskused" : "886M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "startdate" : "25 Sep 08 13:32", "child_nodes" : [], "unix_startdate" : 1757318559, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "max_email_per_hour" : "25", "inodesused" : 42505, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "email" : "topweblogic@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1680252393, "child_nodes" : [], "startdate" : "23 Mar 31 14:16", "owner" : "topweblogic", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 29491, "max_email_per_hour" : "*unknown*", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2125", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "default", "user" : "hddtechnologies", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "866M", "suspendreason" : "not suspended", "domain" : "hddtechnologies.co.in", "ip" : "51.91.152.238" }, { "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1754052511, "child_nodes" : [], "startdate" : "25 Aug 01 18:18", "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 25140, "mailbox_format" : "maildir", "shell" : "/bin/bash", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2192", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "winggolearning_raj", "user" : "auctionmining", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "auctionmining.in", "diskused" : "462M", "suspendreason" : "not suspended" }, { "startdate" : "19 Oct 30 23:35", "child_nodes" : [], "unix_startdate" : 1572458722, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "max_email_per_hour" : "25", "inodesused" : 330, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "user" : "vfoundation", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1333", "maxsql" : "1", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "ip" : "51.91.152.238", "domain" : "vaishnavifoundation.org.in", "suspendreason" : "not suspended", "diskused" : "7M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0" }, { "plan" : "thesunda_cine1024", "user" : "ashishenter", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxsql" : "5", "uid" : "1400", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "3", "ip" : "51.91.152.238", "domain" : "ashishenterprises.com", "diskused" : "2575M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "unix_startdate" : 1700109391, "child_nodes" : [], "startdate" : "23 Nov 16 10:06", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "2048M", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "sacretcode@gmail.com", "maxlst" : "0", "max_email_per_hour" : "25", "inodesused" : 9, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "thesunda" }, { "theme" : "jupiter", "uid" : "1131", "maxsql" : "2", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "plan" : "websbook_1000 MB Linux", "user" : "cryptocbank", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "cryptocbank.com", "diskused" : "6M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "3", "disklimit" : "1000M", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "1", "unix_startdate" : 1517583854, "startdate" : "18 Feb 02 20:34", "child_nodes" : [], "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 275, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "inodesused" : 9, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "thesunda", "child_nodes" : [], "startdate" : "23 Sep 22 14:48", "unix_startdate" : 1695374315, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "sacretcode@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "1024M", "domain" : "hitindia.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "1239M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "hitindia", "plan" : "thesunda_cine1024", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1411", "maxsql" : "5", "theme" : "jupiter", "maxpop" : "3", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited" }, { "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 10639, "max_email_per_hour" : "25", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "1", "has_backup" : 0, "disklimit" : "1000M", "maxsub" : "3", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1572667389, "child_nodes" : [], "startdate" : "19 Nov 02 09:33", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "362M", "suspendreason" : "not suspended", "domain" : "premchandracollege.in", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxsql" : "2", "uid" : "1241", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_1000 MB Linux", "user" : "premchandracolle" }, { "inodesused" : 1001, "max_email_per_hour" : "50", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "apkquest", "child_nodes" : [], "startdate" : "24 Oct 03 11:31", "unix_startdate" : 1727935270, "maxsub" : "10", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "5", "email" : "shiv2144@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "250M", "domain" : "stpeterchayal.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "33M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "stpeterchayal", "plan" : "apkquest_250mb", "outgoing_mail_suspended" : 0, "backup" : 1, "max_emailacct_quota" : "unlimited", "maxftp" : "5", "maxsql" : "10", "uid" : "1385", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "15", "ipv6" : [], "max_defer_fail_percentage" : "10" }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "ramkrishna.org", "ip" : "51.254.16.113", "diskused" : "688M", "suspendreason" : "not suspended", "maxsql" : "unlimited", "uid" : "2392", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "plan" : "winggolearning_raj", "user" : "ramkrishna", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 28421, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "unix_startdate" : 1751287914, "child_nodes" : [], "startdate" : "25 Jun 30 18:21" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 6232, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0, "unix_startdate" : 1490978661, "child_nodes" : [], "startdate" : "17 Mar 31 22:14", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "1", "has_backup" : 0, "disklimit" : "1000M", "maxsub" : "3", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "93M", "suspendreason" : "not suspended", "domain" : "greenlineservice.in", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_1000 MB Linux", "user" : "greenlineservice", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "maxsql" : "2", "uid" : "1160", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter" }, { "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 36049, "max_email_per_hour" : "25", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1731137428, "child_nodes" : [], "startdate" : "24 Nov 09 13:00", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "881M", "suspendreason" : "not suspended", "domain" : "awadhacerashram.com", "ip" : "51.254.16.113", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2194", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "awadhacerashram" }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "sewaskyfoundation.org", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "943M", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2559", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "sewaskyfoundatio", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 68085, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "startdate" : "25 Nov 11 12:32", "child_nodes" : [], "unix_startdate" : 1762844570 }, { "uid" : "2166", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "plan" : "winggolearning_raj", "user" : "adct", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "adct.org.in", "ip" : "51.254.16.113", "diskused" : "900M", "suspendreason" : "not suspended", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1755000199, "startdate" : "25 Aug 12 17:33", "child_nodes" : [], "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 42424, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "361M", "suspendreason" : "not suspended", "domain" : "adhyayabooks.com", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [], "uid" : "1088", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500mb", "user" : "adhyayabooks", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 10479, "max_email_per_hour" : "25", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1588957642, "child_nodes" : [], "startdate" : "20 May 08 22:37" }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 67637, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "startdate" : "26 Apr 14 13:29", "child_nodes" : [], "unix_startdate" : 1776153591, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "centralcarefoundation.com", "suspendreason" : "not suspended", "diskused" : "1347M", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2855", "maxsql" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "user" : "centralcarefound", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2723", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "user" : "bssvfoundation", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "bssvfoundation.in", "suspendreason" : "not suspended", "diskused" : "1154M", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "startdate" : "25 Dec 29 18:35", "child_nodes" : [], "unix_startdate" : 1767013546, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 64669, "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "unix_startdate" : 1765113636, "startdate" : "25 Dec 07 18:50", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 1, "maxsub" : "5", "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "email" : "sachinking151@hotmail.com", "partition" : "home2", "maxlst" : "10", "max_email_per_hour" : "unlimited", "inodesused" : 71229, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 1765953020, "owner" : "dnsscom", "plan" : "dnsscom_Economy", "user" : "eventickz", "backup" : 1, "outgoing_mail_suspended" : 1, "theme" : "jupiter", "maxsql" : "10", "uid" : "2687", "maxftp" : "5", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "10", "ip" : "51.91.152.238", "domain" : "eventickz.com", "diskused" : "658M", "suspendreason" : "Overdue on Payment", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0" }, { "plan" : "winggolearning_raj", "user" : "satyaapath", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "2425", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "satyaapathfoundation.in", "ip" : "51.254.16.113", "diskused" : "1011M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "unix_startdate" : 1722259643, "startdate" : "24 Jul 29 18:57", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 35652, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning" }, { "user" : "strawberrylogist", "plan" : "hhtechsolution_H_Basic", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "2667", "maxsql" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "strawberrylogistics.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "72M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "child_nodes" : [], "startdate" : "22 May 21 13:56", "unix_startdate" : 1653121564, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "250M", "inodesused" : 896, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "hhtechsolution" }, { "ip" : "51.254.16.113", "domain" : "sanatansevarthfoundation.in", "suspendreason" : "not suspended", "diskused" : "5489M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "user" : "sanatansevarthfo", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2414", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "max_email_per_hour" : "25", "inodesused" : 1122647, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "25 Sep 06 20:29", "child_nodes" : [], "unix_startdate" : 1757170745, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2" }, { "maxlst" : "20", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "5000M", "has_backup" : 0, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Oct 06 14:18", "unix_startdate" : 1728204530, "owner" : "hhtechsolution", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 22517, "max_email_per_hour" : "25", "legacy_backup" : 1, "maxpop" : "20", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "5", "uid" : "2617", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "homsofadecor", "plan" : "hhtechsolution_Adv-5GB", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1983M", "domain" : "homsofadecor.com", "ip" : "51.91.152.238" }, { "suspendreason" : "not suspended", "diskused" : "1340M", "ip" : "51.254.16.113", "domain" : "krishnamcare.com", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "krishnamcare", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2862", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 69004, "owner" : "winggolearning", "suspendtime" : 0, "child_nodes" : [], "startdate" : "26 Apr 23 14:01", "unix_startdate" : 1776933062, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited" }, { "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "1", "domain" : "labcare.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "328M", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1476", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "user" : "labcare", "plan" : "royaldiagnosticc_Unlimited plan", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "royaldiagnosticc", "inodesused" : 23385, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "*unknown*", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited", "child_nodes" : [], "startdate" : "25 Feb 10 13:55", "unix_startdate" : 1739175951 }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "10", "ip" : "51.91.152.238", "domain" : "matinlibre.tg", "diskused" : "32916M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "1059", "maxsql" : "20", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "unlimited", "plan" : "otiyahos_ECO", "user" : "wwwinlibre", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "otiyahos", "max_email_per_hour" : "25", "inodesused" : 179793, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "100000M", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "togolais2008@gmail.com", "partition" : "home", "maxlst" : "unlimited", "unix_startdate" : 1714495131, "startdate" : "24 Apr 30 22:08", "child_nodes" : [] }, { "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "212M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "spsphulpur.in", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1312", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500mb", "user" : "spsphulpur", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 2850, "has_backup" : 0, "disklimit" : "500M", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "unix_startdate" : 1602122228, "startdate" : "20 Oct 08 07:27", "child_nodes" : [] }, { "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 28882, "max_email_per_hour" : "25", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Jul 08 16:18", "unix_startdate" : 1720435696, "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "918M", "domain" : "yogeshwarmahadevfoundation.in", "ip" : "51.254.16.113", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2513", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "yogeshwarmahadev", "plan" : "winggolearning_raj" }, { "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "34M", "domain" : "jeevankalyansamiti.org.in", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1180", "maxsql" : "1", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "jeevankalyansami", "plan" : "websbook_linux_500mb", "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 955, "max_email_per_hour" : "25", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "21 May 24 18:53", "child_nodes" : [], "unix_startdate" : 1621862620 }, { "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "*unknown*", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "25 Jun 27 09:28", "child_nodes" : [], "unix_startdate" : 1750996706, "owner" : "royaldiagnosticc", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 11017, "max_email_per_hour" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1966", "maxsql" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "allcaredignostic", "plan" : "royaldiagnosticc_Unlimited", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "466M", "domain" : "allcaredignostic.in", "ip" : "51.91.152.238" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 35298, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1733833427, "child_nodes" : [], "startdate" : "24 Dec 10 17:53", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "diskused" : "867M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "dadosahealthcarefoundation.in", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "dadosahealthcare", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2225", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited" }, { "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "26 Feb 12 11:13", "child_nodes" : [], "unix_startdate" : 1770875033, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 76732, "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2777", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "sanjhasahyogindi", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1036M", "ip" : "51.254.16.113", "domain" : "sanjhasahyogindia.in" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 1420, "owner" : "websbook", "suspendtime" : 0, "startdate" : "19 Nov 01 23:28", "child_nodes" : [], "unix_startdate" : 1572631108, "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "suspendreason" : "not suspended", "diskused" : "479M", "ip" : "51.91.152.238", "domain" : "swargiyabhagwantidevidc.org", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "swargiyabhagwant", "plan" : "websbook_linux_500mb", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1319", "maxsql" : "1" }, { "plan" : "apkquest_250mb", "user" : "gyanamudra", "outgoing_mail_suspended" : 0, "backup" : 1, "maxsql" : "10", "uid" : "1357", "maxftp" : "5", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "15", "legacy_backup" : 1, "max_defer_fail_percentage" : "10", "ipv6" : [], "domain" : "gyanamudra.com", "ip" : "51.91.152.238", "diskused" : "176M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "unix_startdate" : 1727748243, "startdate" : "24 Oct 01 07:34", "child_nodes" : [], "maxsub" : "10", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "5", "disklimit" : "250M", "has_backup" : 0, "inodesused" : 3721, "max_email_per_hour" : "50", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "apkquest" }, { "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "15 Dec 23 17:12", "child_nodes" : [], "unix_startdate" : 1450870966, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 407, "max_email_per_hour" : "25", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1152", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "garibnawazewsorg", "plan" : "websbook_linux_500mb", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "8M", "domain" : "garibnawazews.org.in", "ip" : "51.91.152.238" }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "thebharatprime.com", "ip" : "51.91.152.238", "diskused" : "821M", "suspendreason" : "not suspended", "uid" : "2532", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "thesunda_Metalart2GB", "user" : "thebharatprime", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "thesunda", "inodesused" : 42240, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "bpnewstodayhindi@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "2048M", "unix_startdate" : 1760622017, "startdate" : "25 Oct 16 19:10", "child_nodes" : [] }, { "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1085M", "suspendreason" : "not suspended", "domain" : "waytopackersandmovers.com", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "10", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "uid" : "2679", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "hhtechsolution_H_Adv", "user" : "waytopackersandm", "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 5662, "max_email_per_hour" : "25", "partition" : "home2", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "1", "disklimit" : "1500M", "has_backup" : 0, "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1683960825, "startdate" : "23 May 13 12:23", "child_nodes" : [] }, { "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxsql" : "1", "uid" : "1219", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_Linux_100mb", "user" : "msicorg", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "31M", "suspendreason" : "not suspended", "domain" : "msic.org.in", "ip" : "51.91.152.238", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "0", "disklimit" : "200M", "has_backup" : 0, "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1393439607, "startdate" : "14 Feb 27 00:03", "child_nodes" : [], "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1311, "max_email_per_hour" : "unlimited" }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "child_nodes" : [], "startdate" : "25 Feb 21 11:29", "unix_startdate" : 1740117596, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 47825, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2508", "maxsql" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "user" : "wellwish", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "wellwishfoundation.com", "suspendreason" : "not suspended", "diskused" : "1135M" }, { "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2223", "maxsql" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "csjmuresult", "plan" : "winggolearning_raj", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "46M", "domain" : "csjmu-result.com", "ip" : "51.254.16.113", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "25 Feb 15 14:43", "child_nodes" : [], "unix_startdate" : 1739610802, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 1240, "max_email_per_hour" : "25" }, { "suspendtime" : 0, "owner" : "otiyahos", "inodesused" : 152187, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "togolais2008@gmail.com", "partition" : "home", "outgoing_mail_hold" : 0, "disklimit" : "100000M", "has_backup" : 0, "child_nodes" : [], "startdate" : "23 Apr 26 15:20", "unix_startdate" : 1682502601, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "10", "maxparked" : "0", "domain" : "afrikelles.tg", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "63944M", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "uid" : "1056", "maxsql" : "20", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "user" : "afrikelles", "plan" : "otiyaho1_ECO", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 6761, "max_email_per_hour" : "25", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "3", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1398619622, "child_nodes" : [], "startdate" : "14 Apr 27 22:57", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "595M", "suspendreason" : "not suspended", "domain" : "knapc.org", "ip" : "51.91.152.238", "maxpop" : "3", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxsql" : "2", "uid" : "1193", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500 mb_second", "user" : "knapc" }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "domain" : "partelfibrotech.in", "ip" : "51.91.152.238", "diskused" : "1001M", "suspendreason" : "not suspended", "maxsql" : "2", "uid" : "2134", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "10", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "plan" : "topweblogic_Silver Package", "user" : "partelfibrotech", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "topweblogic", "inodesused" : 9525, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "topweblogic@gmail.com", "maxlst" : "25", "disklimit" : "1000M", "has_backup" : 0, "unix_startdate" : 1716879660, "startdate" : "24 May 28 12:31", "child_nodes" : [] }, { "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "3", "has_backup" : 0, "disklimit" : "1000M", "outgoing_mail_hold" : 0, "email" : "geboya155@gmail.com", "partition" : "home", "maxlst" : "1", "unix_startdate" : 1625921530, "startdate" : "21 Jul 10 18:22", "child_nodes" : [], "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 538, "mailbox_format" : "maildir", "shell" : "/bin/bash", "theme" : "jupiter", "uid" : "1305", "maxsql" : "2", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "plan" : "websbook_1000 MB Linux", "user" : "sntadmission", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "sntcollegeadmission.org.in", "diskused" : "10M", "suspendreason" : "not suspended" }, { "maxftp" : "10", "max_emailacct_quota" : "unlimited", "uid" : "1055", "maxsql" : "20", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "user" : "sosports", "plan" : "otiyahos_ECO", "outgoing_mail_suspended" : 0, "backup" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "10", "maxparked" : "0", "domain" : "sosports.tg", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "47516M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "togolais2008@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home", "disklimit" : "100000M", "has_backup" : 0, "startdate" : "24 Mar 16 09:22", "child_nodes" : [], "unix_startdate" : 1710561146, "suspendtime" : 0, "owner" : "otiyahos", "inodesused" : 203070, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "494M", "ip" : "51.91.152.238", "domain" : "winggolearning.com", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2516", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "winggolearning", "plan" : "RED903RESELLER", "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 21729, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "*unknown*", "partition" : "home2", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "25 Oct 01 10:18", "unix_startdate" : 1759294119 }, { "diskused" : "366M", "suspendreason" : "not suspended", "domain" : "mrrfoods.com", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "hhtechsolution_H_Adv", "user" : "mrrfoods", "legacy_backup" : 1, "maxpop" : "10", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxsql" : "1", "uid" : "2637", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1807, "max_email_per_hour" : "25", "owner" : "hhtechsolution", "suspendtime" : 0, "unix_startdate" : 1628820759, "child_nodes" : [], "startdate" : "21 Aug 13 07:42", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "1", "disklimit" : "1500M", "has_backup" : 0, "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0 }, { "disklimit" : "25000M", "has_backup" : 0, "maxlst" : "10", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "10", "child_nodes" : [], "startdate" : "21 Jun 23 21:59", "unix_startdate" : 1624465784, "owner" : "websiteg", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 2199, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "10", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "maxsql" : "10", "uid" : "1095", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "apptla", "plan" : "undefined", "maxaddons" : "5", "maxparked" : "10", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1720M", "ip" : "51.91.152.238", "domain" : "apptla.com" }, { "unix_startdate" : 1770881498, "child_nodes" : [], "startdate" : "26 Feb 12 13:01", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 82641, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "plan" : "winggolearning_raj", "user" : "aayogcarefoundat", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "2778", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "aayogcarefoundation.org", "ip" : "51.254.16.113", "diskused" : "1391M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1" }, { "suspendreason" : "not suspended", "diskused" : "15M", "domain" : "gpdegreecollege.org", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "gpdegree", "plan" : "websbook_Linux_100mb", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "uid" : "1158", "maxsql" : "1", "theme" : "jupiter", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 533, "max_email_per_hour" : "unlimited", "owner" : "websbook", "suspendtime" : 0, "startdate" : "18 Jan 23 18:58", "child_nodes" : [], "unix_startdate" : 1516714134, "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "has_backup" : 0, "disklimit" : "200M", "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited" }, { "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "2641", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "professionalsout", "plan" : "hhtechsolution_H_Basic", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "30M", "domain" : "professionalsouthlogistic.in", "ip" : "51.91.152.238", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "has_backup" : 0, "disklimit" : "250M", "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "23 Dec 22 22:20", "unix_startdate" : 1703263854, "owner" : "hhtechsolution", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 659, "max_email_per_hour" : "25" }, { "startdate" : "25 Jun 25 18:04", "child_nodes" : [], "unix_startdate" : 1750854890, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "max_email_per_hour" : "25", "inodesused" : 45663, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "user" : "fosterwelfare", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2251", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "ip" : "51.254.16.113", "domain" : "fosterwelfarefoundation.in", "suspendreason" : "not suspended", "diskused" : "1053M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1" }, { "maxsql" : "unlimited", "uid" : "2536", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "plan" : "winggolearning_raj", "user" : "rastriyahinduekt", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "rastriyahinduektasangh.com", "ip" : "51.254.16.113", "diskused" : "1007M", "suspendreason" : "not suspended", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "unix_startdate" : 1760775395, "startdate" : "25 Oct 18 13:46", "child_nodes" : [], "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 44428, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "100000M", "outgoing_mail_hold" : 0, "email" : "agenceotiya@gmail.com", "partition" : "home", "maxlst" : "unlimited", "unix_startdate" : 1732120720, "child_nodes" : [], "startdate" : "24 Nov 20 22:08", "suspendtime" : 0, "owner" : "otiyahos", "max_email_per_hour" : "25", "inodesused" : 61357, "mailbox_format" : "maildir", "shell" : "/bin/bash", "theme" : "jupiter", "uid" : "1065", "maxsql" : "20", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "unlimited", "plan" : "otiyahos_ECO", "user" : "chandeltv", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "10", "ip" : "51.91.152.238", "domain" : "chandeltv.tg", "diskused" : "2675M", "suspendreason" : "not suspended" }, { "owner" : "topweblogic", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "*unknown*", "inodesused" : 25716, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "topweblogic@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "23 Aug 04 11:58", "unix_startdate" : 1691130530, "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "584M", "ip" : "51.91.152.238", "domain" : "beautyzonebaroda.com", "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2112", "maxsql" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "beautyzonebaroda", "plan" : "default" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "incentivefosterf", "plan" : "winggolearning_raj", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2860", "maxsql" : "unlimited", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "1748M", "domain" : "incentivefosterfoundationiff.org", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "startdate" : "26 Apr 20 18:46", "child_nodes" : [], "unix_startdate" : 1776690996, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 71285, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "eksathudaanfound", "plan" : "winggolearning_raj", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2702", "suspendreason" : "not suspended", "diskused" : "1144M", "ip" : "51.254.16.113", "domain" : "eksathudaanfoundation.com", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "startdate" : "25 Dec 13 13:00", "child_nodes" : [], "unix_startdate" : 1765611026, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 43250, "owner" : "winggolearning", "suspendtime" : 0 }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "kngddegreecollege.org", "ip" : "51.91.152.238", "diskused" : "17M", "suspendreason" : "not suspended", "uid" : "1194", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [], "plan" : "websbook_linux_500mb", "user" : "kngddegreecolleg", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 520, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "unix_startdate" : 1563449365, "startdate" : "19 Jul 18 16:59", "child_nodes" : [] }, { "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "250M", "startdate" : "23 Sep 01 09:55", "child_nodes" : [], "unix_startdate" : 1693542318, "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 1014, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2654", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "sariinutrifoods", "plan" : "hhtechsolution_H_Basic", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "sariinutrifoods.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "119M" }, { "inodesused" : 8237, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1618644023, "child_nodes" : [], "startdate" : "21 Apr 17 12:50", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0, "domain" : "legalmoth.online", "ip" : "51.91.152.238", "diskused" : "274M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "plan" : "websbook_linux_500mb", "user" : "legalonline", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "1200", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [] }, { "unix_startdate" : 1360953888, "child_nodes" : [], "startdate" : "13 Feb 16 00:14", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "0", "disklimit" : "200M", "has_backup" : 0, "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 891, "max_email_per_hour" : "unlimited", "owner" : "websbook", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_Linux_100mb", "user" : "citizenc", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "uid" : "1123", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "theme" : "jupiter", "diskused" : "14M", "suspendreason" : "not suspended", "domain" : "citizencollege.org.in", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "unix_startdate" : 1719290852, "startdate" : "24 Jun 25 10:17", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home", "email" : "tjvinder@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "max_email_per_hour" : "unlimited", "inodesused" : 44367, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "root", "plan" : "RED31RESELLER", "user" : "misakic2", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1060", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "unlimited", "ip" : "51.91.152.238", "domain" : "misakicreations.com", "diskused" : "937M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0" }, { "startdate" : "25 Apr 14 08:24", "child_nodes" : [], "unix_startdate" : 1744599258, "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "1", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "*unknown*", "disklimit" : "1500M", "has_backup" : 0, "inodesused" : 10426, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "hhtechsolution", "user" : "sarktours", "plan" : "hhtechsolution_H_Adv", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "2655", "maxsql" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "10", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "domain" : "sarktours.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "818M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0" }, { "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "unicarebpt.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "248M", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1499", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "user" : "unicarebpt", "plan" : "royaldiagnosticc_Unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "royaldiagnosticc", "inodesused" : 21453, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "*unknown*", "partition" : "home2", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "startdate" : "24 Jun 12 09:07", "child_nodes" : [], "unix_startdate" : 1718163455 }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 2856, "max_email_per_hour" : "unlimited", "owner" : "websbook", "suspendtime" : 0, "unix_startdate" : 1362212584, "child_nodes" : [], "startdate" : "13 Mar 02 13:53", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0", "disklimit" : "200M", "has_backup" : 0, "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "79M", "suspendreason" : "not suspended", "domain" : "gsnpgcollege.org.in", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_Linux_100mb", "user" : "gsnmahav", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxsql" : "1", "uid" : "1161", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "theme" : "jupiter" }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "has_backup" : 0, "disklimit" : "250M", "maxlst" : "unlimited", "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "child_nodes" : [], "startdate" : "22 Nov 17 16:26", "unix_startdate" : 1668682584, "suspendtime" : 0, "owner" : "hhtechsolution", "max_email_per_hour" : "25", "inodesused" : 9, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "2609", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "5", "legacy_backup" : 1, "user" : "fastfreightlogis", "plan" : "hhtechsolution_H_Basic", "outgoing_mail_suspended" : 0, "backup" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "fastfreightlogistics.in", "suspendreason" : "not suspended", "diskused" : "306M" }, { "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 651, "max_email_per_hour" : "25", "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "250M", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1765246015, "child_nodes" : [], "startdate" : "25 Dec 09 07:36", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "26M", "suspendreason" : "not suspended", "domain" : "jupiter-corporation.com", "ip" : "51.91.152.238", "maxpop" : "5", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "1", "uid" : "2690", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "hhtechsolution_H_Basic", "user" : "corporatjupiter" }, { "inodesused" : 42671, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "25 Sep 29 16:23", "child_nodes" : [], "unix_startdate" : 1759143180, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "domain" : "jansevasamarpantrust.org", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "884M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "user" : "pantrustjan", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2369", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30" }, { "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "973M", "suspendreason" : "not suspended", "domain" : "premjansewacharitabletrust.in", "ip" : "51.254.16.113", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "unlimited", "uid" : "2383", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "premjansewa", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 46746, "max_email_per_hour" : "25", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1747909005, "startdate" : "25 May 22 15:46", "child_nodes" : [] }, { "user" : "vidyatrust", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2773", "maxsql" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "ip" : "51.254.16.113", "domain" : "vidyatrust.in", "suspendreason" : "not suspended", "diskused" : "917M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "child_nodes" : [], "startdate" : "26 Feb 09 12:35", "unix_startdate" : 1770620712, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "max_email_per_hour" : "25", "inodesused" : 70391, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 44782, "max_email_per_hour" : "25", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1752566711, "child_nodes" : [], "startdate" : "25 Jul 15 13:35", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "920M", "suspendreason" : "not suspended", "domain" : "hashmifoundation.co.in", "ip" : "51.254.16.113", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2266", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "hashmifoundation" }, { "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "5", "uid" : "1399", "theme" : "jupiter", "maxpop" : "3", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "user" : "acmeauto", "plan" : "thesunda_cine1024", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "acmeauto.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "833M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "partition" : "home2", "email" : "sacretcode@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "1024M", "has_backup" : 0, "startdate" : "24 Dec 03 16:33", "child_nodes" : [], "unix_startdate" : 1733223819, "suspendtime" : 0, "owner" : "thesunda", "inodesused" : 6581, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "ceducarefoundation.in", "diskused" : "981M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "2710", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "plan" : "winggolearning_raj", "user" : "ceducarefoundati", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 59443, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1766221529, "child_nodes" : [], "startdate" : "25 Dec 20 14:35" }, { "suspendreason" : "not suspended", "diskused" : "10M", "domain" : "rnsiti.in", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "rnsitiin", "plan" : "websbook_linux_500mb", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1263", "maxsql" : "1", "theme" : "jupiter", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 660, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0, "child_nodes" : [], "startdate" : "16 May 18 02:02", "unix_startdate" : 1463517171, "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited" }, { "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 2133, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "child_nodes" : [], "startdate" : "22 Dec 19 15:01", "unix_startdate" : 1671442319, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "rajpc.in", "suspendreason" : "not suspended", "diskused" : "41M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "1249", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "user" : "rajpara", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "unix_startdate" : 1758276529, "startdate" : "25 Sep 19 15:38", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 45075, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "plan" : "winggolearning_raj", "user" : "khariyagoshala", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "2310", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "khariyagoshalachuru.org", "ip" : "51.254.16.113", "diskused" : "1169M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "otiyahos_ECO", "user" : "agbozegue", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxsql" : "20", "uid" : "1016", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "5288M", "suspendreason" : "not suspended", "domain" : "agbozegue.org", "ip" : "51.91.152.238", "maxaddons" : "10", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1694754176, "startdate" : "23 Sep 15 10:32", "child_nodes" : [], "partition" : "home", "email" : "agenceotiya@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "100000M", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 38653, "max_email_per_hour" : "25", "owner" : "otiyahos", "suspendtime" : 0 }, { "domain" : "mahiaquaservices.online", "ip" : "51.91.152.238", "diskused" : "499M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "plan" : "websbook_linux_500mb", "user" : "sahyogindustries", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "1269", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "inodesused" : 36662, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1619327114, "child_nodes" : [], "startdate" : "21 Apr 25 10:35", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0 }, { "domain" : "hopunity.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1196M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "user" : "hopunity", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2275", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "inodesused" : 39535, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "25 Jan 09 16:20", "child_nodes" : [], "unix_startdate" : 1736419828, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 43929, "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "25 Oct 17 12:38", "child_nodes" : [], "unix_startdate" : 1760684898, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "suspendreason" : "not suspended", "diskused" : "992M", "ip" : "51.254.16.113", "domain" : "ssindiantrust.in", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "ssindiantrust", "plan" : "winggolearning_raj", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2533", "maxsql" : "unlimited" }, { "ip" : "51.254.16.113", "domain" : "madhuramuniversalfoundation.com", "diskused" : "873M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "plan" : "winggolearning_raj", "user" : "madhuramuniversa", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2783", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 66175, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1771313754, "child_nodes" : [], "startdate" : "26 Feb 17 13:05", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited" }, { "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "websofttechnoIogiesindia@yahoo.com", "has_backup" : 0, "disklimit" : "unlimited", "startdate" : "13 Feb 14 09:34", "child_nodes" : [], "unix_startdate" : 1360814685, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 65340, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1076", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "user" : "websbook", "plan" : "RED902RESELLER", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "unlimited", "maxaddons" : "unlimited", "domain" : "websbook.co.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "1244M" }, { "child_nodes" : [], "startdate" : "24 Sep 20 18:16", "unix_startdate" : 1726836380, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 48442, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "user" : "sammarpan", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2519", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "samarpanfoundations.org", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1084M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1" }, { "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "911M", "suspendreason" : "not suspended", "domain" : "tatvamasicharitabletrust.in", "ip" : "51.254.16.113", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2478", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "tatvamasicharita", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 43074, "max_email_per_hour" : "25", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1756477179, "startdate" : "25 Aug 29 19:49", "child_nodes" : [] }, { "theme" : "jupiter", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1314", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "5", "legacy_backup" : 1, "user" : "ssmmahavidyalaya", "plan" : "websbook_Linux_100mb", "outgoing_mail_suspended" : 0, "backup" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "ssmmahavidyalaya.org", "suspendreason" : "not suspended", "diskused" : "15M", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "has_backup" : 0, "disklimit" : "200M", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "child_nodes" : [], "startdate" : "17 Sep 17 18:15", "unix_startdate" : 1505652309, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "unlimited", "inodesused" : 634, "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "domain" : "india4all.org", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "146M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "india4all", "plan" : "apkquest_250mb", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "5", "max_emailacct_quota" : "unlimited", "maxsql" : "10", "uid" : "1359", "theme" : "jupiter", "maxpop" : "15", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "10", "inodesused" : 912, "max_email_per_hour" : "50", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "apkquest", "child_nodes" : [], "startdate" : "24 Oct 01 07:47", "unix_startdate" : 1727749055, "maxsub" : "10", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "5", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home2", "disklimit" : "250M", "has_backup" : 0 }, { "domain" : "thyrocarebpt.in", "ip" : "51.91.152.238", "diskused" : "368M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "0", "plan" : "royaldiagnosticc_Unlimited plan", "user" : "thyrocare", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "1498", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "inodesused" : 26862, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "royaldiagnosticc", "unix_startdate" : 1735132948, "startdate" : "24 Dec 25 18:52", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited" }, { "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 43290, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "startdate" : "25 Oct 27 11:10", "child_nodes" : [], "unix_startdate" : 1761543605, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "ariffatimarihana.org", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "954M", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2544", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "ariffatimarihana", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "gautengbusiness.co.za", "suspendreason" : "not suspended", "diskused" : "2434M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2159", "maxsql" : "unlimited", "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "user" : "gautengbusinessc", "plan" : "default", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "topweblogic", "max_email_per_hour" : "*unknown*", "inodesused" : 60394, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "startdate" : "17 Aug 18 00:34", "child_nodes" : [], "unix_startdate" : 1502996697 }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 67048, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1773667043, "child_nodes" : [], "startdate" : "26 Mar 16 18:47", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "shriramsewasamitii.com", "diskused" : "944M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "2816", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "plan" : "winggolearning_raj", "user" : "ramsamitsewa", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "unix_startdate" : 1362127777, "child_nodes" : [], "startdate" : "13 Mar 01 14:19", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "has_backup" : 0, "disklimit" : "200M", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "max_email_per_hour" : "unlimited", "inodesused" : 1316, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "plan" : "websbook_Linux_100mb", "user" : "ramdular", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxsql" : "1", "uid" : "1250", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "ip" : "51.91.152.238", "domain" : "ramdularsinghsmarakdegreecollege.org.in", "diskused" : "37M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0" }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "domain" : "paraskapoorji.in", "ip" : "51.91.152.238", "diskused" : "244M", "suspendreason" : "not suspended", "maxsql" : "2", "uid" : "1231", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "maxpop" : "10", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "plan" : "websbook_linux_2000mb", "user" : "paraskapoorji", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 9844, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "10", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "10", "has_backup" : 0, "disklimit" : "2000M", "unix_startdate" : 1570002438, "startdate" : "19 Oct 02 13:17", "child_nodes" : [] }, { "disklimit" : "5000M", "has_backup" : 0, "maxlst" : "20", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "child_nodes" : [], "startdate" : "24 Nov 09 07:20", "unix_startdate" : 1731117013, "owner" : "hhtechsolution", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 13234, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "20", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "5", "uid" : "2650", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "sadhanayogalaya", "plan" : "hhtechsolution_Adv-5GB", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "366M", "ip" : "51.91.152.238", "domain" : "sadhanayogalaya.com" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 309, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "child_nodes" : [], "startdate" : "26 Jan 22 19:49", "unix_startdate" : 1769091542, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "4M", "domain" : "biourjamission.org", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "biourjamission", "plan" : "winggolearning_raj", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2753", "maxsql" : "unlimited", "theme" : "jupiter" }, { "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "unix_startdate" : 1770269519, "child_nodes" : [], "startdate" : "26 Feb 05 11:01", "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 68200, "mailbox_format" : "maildir", "shell" : "/bin/bash", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2766", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "plan" : "winggolearning_raj", "user" : "kbcf", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "kbcf.club", "diskused" : "1368M", "suspendreason" : "not suspended" }, { "suspendreason" : "not suspended", "diskused" : "493M", "domain" : "actscolleges.org", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "actscollege", "plan" : "hhtechsolution_H_Adv", "maxpop" : "10", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "2588", "theme" : "jupiter", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 5382, "max_email_per_hour" : "25", "owner" : "hhtechsolution", "suspendtime" : 0, "child_nodes" : [], "startdate" : "22 May 19 10:15", "unix_startdate" : 1652935550, "maxlst" : "1", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "theocontact@yahoo.com, actioncontact@yahoo.com", "has_backup" : 0, "disklimit" : "1500M", "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited" }, { "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 44557, "max_email_per_hour" : "25", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1752664657, "child_nodes" : [], "startdate" : "25 Jul 16 16:47", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "906M", "suspendreason" : "not suspended", "domain" : "vidyanarirakshacharitabletrust.in", "ip" : "51.254.16.113", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2494", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "vidyanariraksha" }, { "unix_startdate" : 1745904161, "child_nodes" : [], "startdate" : "25 Apr 29 10:52", "disklimit" : "250M", "has_backup" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 1187, "owner" : "hhtechsolution", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "hhtechsolution_H_Basic", "user" : "royalcrystaltrad", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "1", "uid" : "2649", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "diskused" : "89M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "royalcrystaltrading.com", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "3", "disklimit" : "1000M", "has_backup" : 0, "maxlst" : "1", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "child_nodes" : [], "startdate" : "21 Sep 22 12:38", "unix_startdate" : 1632294489, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 113, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "2", "uid" : "1135", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "user" : "demo", "plan" : "websbook_1000 MB Linux", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "demo.xyz", "suspendreason" : "not suspended", "diskused" : "3M" }, { "owner" : "royaldiagnosticc", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 9102, "disklimit" : "unlimited", "has_backup" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1752213123, "startdate" : "25 Jul 11 11:22", "child_nodes" : [], "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "249M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "arhaanmedical.in", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "uid" : "1973", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "royaldiagnosticc_Unlimited", "user" : "arhaanmedical" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 1169, "max_email_per_hour" : "unlimited", "owner" : "websbook", "suspendtime" : 0, "child_nodes" : [], "startdate" : "13 Mar 02 13:55", "unix_startdate" : 1362212750, "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "disklimit" : "200M", "has_backup" : 0, "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "28M", "domain" : "bssss.org", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "bssss", "plan" : "websbook_Linux_100mb", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1116", "theme" : "jupiter" }, { "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 45501, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "child_nodes" : [], "startdate" : "25 Jul 02 17:16", "unix_startdate" : 1751456768, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "isssindia.org", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "920M", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2289", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "user" : "isssindia", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "174M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "kulapullysreekrishnatemple.com", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2632", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "hhtechsolution_H_Basic", "user" : "kulapullysreekri", "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 1332, "disklimit" : "250M", "has_backup" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "unix_startdate" : 1653288689, "child_nodes" : [], "startdate" : "22 May 23 12:21" }, { "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "uid" : "1465", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "default", "user" : "aptechco", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "2997M", "suspendreason" : "not suspended", "domain" : "aptechcomputer.in", "ip" : "51.91.152.238", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "ashiqulrahman175@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1614932345, "child_nodes" : [], "startdate" : "21 Mar 05 13:49", "owner" : "royaldiagnosticc", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 101648, "max_email_per_hour" : "*unknown*" }, { "diskused" : "48M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "shriradhekunj.com", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "sriradekunj", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxsql" : "1", "uid" : "1290", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 1277, "owner" : "websbook", "suspendtime" : 0, "unix_startdate" : 1503652038, "startdate" : "17 Aug 25 14:37", "child_nodes" : [], "disklimit" : "500M", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0" }, { "child_nodes" : [], "startdate" : "25 Apr 28 15:19", "unix_startdate" : 1745833794, "disklimit" : "2048M", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 22633, "owner" : "apkquest", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "crystology", "plan" : "apkquest_2gb", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1355", "suspendreason" : "not suspended", "diskused" : "614M", "ip" : "51.91.152.238", "domain" : "crystology.in", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0 }, { "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 80344, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "startdate" : "26 Feb 07 16:38", "child_nodes" : [], "unix_startdate" : 1770462515, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "impactsparkfoundation.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1694M", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2771", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "impactsparkfound", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "17M", "ip" : "51.91.152.238", "domain" : "hsdvidhimahavidyalaya.org.in", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "maxsql" : "1", "uid" : "1169", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "hsdvidhimahavidy", "plan" : "websbook_Linux_100mb", "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 405, "disklimit" : "200M", "has_backup" : 0, "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "startdate" : "23 Sep 27 19:01", "child_nodes" : [], "unix_startdate" : 1695821486 }, { "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "146M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "newyearpartyinlucknow.in", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2545", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "newyearparty", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 12733, "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1761552948, "child_nodes" : [], "startdate" : "25 Oct 27 13:45" }, { "suspendreason" : "not suspended", "diskused" : "193M", "ip" : "51.91.152.238", "domain" : "sujataonlinecentre.in", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "satyam1993", "plan" : "thesunda_cine1024_ltlfilms", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "4", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2584", "maxsql" : "2", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 6631, "owner" : "thesunda", "suspendtime" : 0, "startdate" : "25 Dec 05 01:02", "child_nodes" : [], "unix_startdate" : 1764876741, "has_backup" : 0, "disklimit" : "1024M", "maxlst" : "0", "email" : "satyamkumarroy007@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0" }, { "ip" : "51.91.152.238", "domain" : "colourful-zone.com", "suspendreason" : "not suspended", "diskused" : "10605M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "unlimited", "maxaddons" : "4", "user" : "colourfu", "plan" : "Red13Backup", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1007", "max_defer_fail_percentage" : "10", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "max_email_per_hour" : "100", "inodesused" : 272539, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "root", "child_nodes" : [], "startdate" : "20 Nov 19 20:20", "unix_startdate" : 1605797455, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "rohitrana2411@gmail.com", "partition" : "home" }, { "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 47231, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "unix_startdate" : 1729324034, "child_nodes" : [], "startdate" : "24 Oct 19 13:17", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "danzarefoundation.in", "ip" : "51.254.16.113", "diskused" : "1062M", "suspendreason" : "not suspended", "maxsql" : "unlimited", "uid" : "2226", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "plan" : "winggolearning_raj", "user" : "danzare", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "unix_startdate" : 1677332144, "child_nodes" : [], "startdate" : "23 Feb 25 19:05", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "apex4kc@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 8478, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "root", "plan" : "RED13HOSTING", "user" : "tunnelcr", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "1545", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "domain" : "tunnelcruiseexpress.com", "ip" : "51.91.152.238", "diskused" : "271M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "unlimited", "maxaddons" : "4" }, { "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "disklimit" : "500M", "has_backup" : 0, "startdate" : "16 Jan 27 13:25", "child_nodes" : [], "unix_startdate" : 1453881349, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 6146, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1171", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "user" : "ijspvidyalaya", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "ijspmahavidyalaya.org.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "207M" }, { "inodesused" : 2150, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "child_nodes" : [], "startdate" : "19 Apr 03 21:40", "unix_startdate" : 1554307840, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "has_backup" : 0, "disklimit" : "500M", "domain" : "dklp.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "61M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "dklp", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1138", "maxsql" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [] }, { "unix_startdate" : 1572674541, "child_nodes" : [], "startdate" : "19 Nov 02 11:32", "disklimit" : "500M", "has_backup" : 0, "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 974, "owner" : "websbook", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500mb", "user" : "ksinfraprojects", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1197", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "diskused" : "379M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "ksinfraprojects.in", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "suspendtime" : 0, "owner" : "websbook", "inodesused" : 1727, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "disklimit" : "200M", "has_backup" : 0, "unix_startdate" : 1387775854, "startdate" : "13 Dec 23 10:47", "child_nodes" : [], "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "sbssmbtc.org.in", "ip" : "51.91.152.238", "diskused" : "32M", "suspendreason" : "not suspended", "uid" : "1281", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "plan" : "websbook_Linux_100mb", "user" : "sbssmbtc", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "disklimit" : "2000M", "has_backup" : 0, "maxlst" : "25", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "startdate" : "22 Sep 15 15:08", "child_nodes" : [], "unix_startdate" : 1663234697, "owner" : "topweblogic", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 114, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "10", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "5", "uid" : "2145", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "weblogic", "plan" : "topweblogic_Gold Package", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "2M", "ip" : "51.91.152.238", "domain" : "topweblogic.co.in" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "subhaarambhwelfa", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2469", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "diskused" : "912M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "subhaarambhwelfarefoundation.in", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1753352075, "child_nodes" : [], "startdate" : "25 Jul 24 15:44", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 44626, "owner" : "winggolearning", "suspendtime" : 0 }, { "unix_startdate" : 1733839360, "startdate" : "24 Dec 10 19:32", "child_nodes" : [], "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 48782, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "tamilnadu", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2476", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "1352M", "suspendreason" : "not suspended", "domain" : "tamilnaduvolunteers.org", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "25 Feb 22 12:44", "child_nodes" : [], "unix_startdate" : 1740208451, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 46268, "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2184", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "arbtrust", "plan" : "winggolearning_raj", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "992M", "ip" : "51.254.16.113", "domain" : "arbtrust.co.in" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "nhtrust", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2529", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "875M", "suspendreason" : "not suspended", "domain" : "nhtrust.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1760360686, "startdate" : "25 Oct 13 18:34", "child_nodes" : [], "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 42306, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 17811, "max_email_per_hour" : "25", "owner" : "otiyahos", "suspendtime" : 1712296581, "startdate" : "21 Jul 05 02:24", "child_nodes" : [], "unix_startdate" : 1625432086, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "togolais2008@gmail.com", "partition" : "home", "disklimit" : "100000M", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 1, "inodeslimit" : "unlimited", "suspendreason" : "Payement en retard", "diskused" : "2593M", "domain" : "nevents.tg", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "10", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 1, "user" : "nevents", "plan" : "otiyahos_ECO", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "maxsql" : "20", "uid" : "1029", "theme" : "jupiter" }, { "suspendtime" : 0, "owner" : "skystechnology", "inodesused" : 1509, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "dellemc.ind@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1738568974, "startdate" : "25 Feb 03 13:19", "child_nodes" : [], "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "5", "maxparked" : "5", "domain" : "dellnextgen.com", "ip" : "51.91.152.238", "diskused" : "64M", "suspendreason" : "not suspended", "maxsql" : "unlimited", "uid" : "1393", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "plan" : "skystechnology_skystech_premium_ornests", "user" : "dellnextgen", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "10", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "2", "uid" : "2110", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "amitjani", "plan" : "topweblogic_Silver Package", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "974M", "ip" : "51.91.152.238", "domain" : "amitjani.com", "disklimit" : "1000M", "has_backup" : 0, "maxlst" : "25", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "child_nodes" : [], "startdate" : "21 Sep 09 15:58", "unix_startdate" : 1631183308, "owner" : "topweblogic", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 31879 }, { "domain" : "legalmoth.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "54M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "legalmoth", "plan" : "websbook_1000 MB Linux", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "2", "uid" : "1199", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "inodesused" : 8049, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "startdate" : "20 Nov 20 18:09", "child_nodes" : [], "unix_startdate" : 1605875986, "maxsub" : "3", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "1", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "1000M" }, { "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1266M", "ip" : "51.254.16.113", "domain" : "jeevansuraksha.org", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2299", "maxsql" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "jeevansuraksha", "plan" : "winggolearning_raj", "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 62634, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "25 Apr 10 12:12", "child_nodes" : [], "unix_startdate" : 1744267341 }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "shaktiincoporation.com", "ip" : "51.91.152.238", "diskused" : "99M", "suspendreason" : "not suspended", "uid" : "2660", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "30", "ipv6" : [], "plan" : "hhtechsolution_H_Basic", "user" : "shaktiincoporati", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 1028, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "250M", "unix_startdate" : 1671621191, "child_nodes" : [], "startdate" : "22 Dec 21 16:43" }, { "diskused" : "130M", "suspendreason" : "not suspended", "domain" : "shankaramovies.com", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "default", "user" : "shankara", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxsql" : "unlimited", "uid" : "1433", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 5518, "max_email_per_hour" : "100", "owner" : "thesunda", "suspendtime" : 0, "unix_startdate" : 1596349263, "child_nodes" : [], "startdate" : "20 Aug 02 11:51", "partition" : "home2", "email" : "sacretcode@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 2548, "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "startdate" : "16 Jul 17 11:34", "child_nodes" : [], "unix_startdate" : 1468735499, "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "31M", "ip" : "51.91.152.238", "domain" : "dsmlawcollege.org.in", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1145", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "dsmlawcollege", "plan" : "websbook_linux_500mb" }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "disklimit" : "250M", "has_backup" : 0, "maxlst" : "unlimited", "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "child_nodes" : [], "startdate" : "26 Mar 15 11:12", "unix_startdate" : 1773553374, "suspendtime" : 0, "owner" : "hhtechsolution", "max_email_per_hour" : "25", "inodesused" : 655, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2814", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "5", "user" : "vkcargomoversind", "plan" : "hhtechsolution_H_Basic", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "vkcargomoversind.com", "suspendreason" : "not suspended", "diskused" : "38M" }, { "domain" : "aronax.org", "ip" : "51.254.16.113", "diskused" : "1330M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "plan" : "winggolearning_raj", "user" : "aronax", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "2185", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "inodesused" : 47024, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1751639161, "startdate" : "25 Jul 04 19:56", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0 }, { "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "has_backup" : 0, "disklimit" : "200M", "startdate" : "16 Feb 04 15:41", "child_nodes" : [], "unix_startdate" : 1454580690, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 641, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "maxsql" : "1", "uid" : "1293", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "user" : "shrividyalaya", "plan" : "websbook_Linux_100mb", "outgoing_mail_suspended" : 0, "backup" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "shrisahdevpaudhariyavidyalaya.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "47M" }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 46267, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "child_nodes" : [], "startdate" : "25 Apr 30 14:47", "unix_startdate" : 1746004653, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "prabhaprakashrastrakalyantrust.in", "suspendreason" : "not suspended", "diskused" : "1036M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2380", "maxsql" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "user" : "prabhaprakash", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 2230, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "unix_startdate" : 1572629375, "startdate" : "19 Nov 01 22:59", "child_nodes" : [], "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "vdcollege.org", "diskused" : "234M", "suspendreason" : "not suspended", "theme" : "jupiter", "maxsql" : "1", "uid" : "1329", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "plan" : "websbook_linux_500mb", "user" : "vdcolle", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "mrpoly", "plan" : "royaldiagnosticc_Unlimited", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2537", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "192M", "domain" : "mrpoly.in", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "startdate" : "25 Oct 23 07:58", "child_nodes" : [], "unix_startdate" : 1761186500, "maxlst" : "unlimited", "partition" : "home2", "email" : "*unknown*", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 17706, "max_email_per_hour" : "unlimited", "owner" : "royaldiagnosticc", "suspendtime" : 0 }, { "unix_startdate" : 1474369515, "child_nodes" : [], "startdate" : "16 Sep 20 16:35", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "0", "max_email_per_hour" : "25", "inodesused" : 1468, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "plan" : "websbook_linux_500mb", "user" : "jssvm", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "1189", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "jssvm.org.in", "diskused" : "59M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0" }, { "ip" : "51.91.152.238", "domain" : "phpwebspinner.com", "suspendreason" : "not suspended", "diskused" : "10560M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "4", "maxparked" : "unlimited", "user" : "phpwebsp", "plan" : "RED13HOSTING", "outgoing_mail_suspended" : 1, "backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1079", "maxsql" : "unlimited", "max_defer_fail_percentage" : "1", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "max_email_per_hour" : "30", "inodesused" : 113269, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "root", "startdate" : "19 Mar 09 23:01", "child_nodes" : [], "unix_startdate" : 1552152716, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "julistong@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home" }, { "has_backup" : 0, "disklimit" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1746696432, "startdate" : "25 May 08 14:57", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 47727, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2438", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "sgnfoundation", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1034M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "sgnfoundation.org" }, { "domain" : "lapokart.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "3096M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "unlimited", "maxaddons" : "1", "user" : "lapokart", "plan" : "RED92SSD", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1969", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "inodesused" : 11727, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "root", "startdate" : "25 Jul 07 17:10", "child_nodes" : [], "unix_startdate" : 1751888422, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "samparkpoint@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "20480M" }, { "maxftp" : "0", "max_emailacct_quota" : "unlimited", "uid" : "1270", "maxsql" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "user" : "saikripadharmtru", "plan" : "websbook_Linux_100mb", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "saikripadharmtrust.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "31M", "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "has_backup" : 0, "disklimit" : "200M", "child_nodes" : [], "startdate" : "15 Oct 30 10:33", "unix_startdate" : 1446181390, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 1137, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "unix_startdate" : 1775726591, "child_nodes" : [], "startdate" : "26 Apr 09 14:53", "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 66865, "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "rudraksabalaji", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2846", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "diskused" : "877M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "rudraksa-balaji-krishna.org", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2829", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "shriaisahebfound", "plan" : "winggolearning_raj", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "825M", "domain" : "shriaisahebfoundation.in", "ip" : "51.254.16.113", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "26 Mar 31 17:09", "child_nodes" : [], "unix_startdate" : 1774957164, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 66734, "max_email_per_hour" : "25" }, { "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1537", "outgoing_mail_suspended" : 1, "backup" : 1, "user" : "indzilla", "plan" : "Red91Solid", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "Overdue on Payment", "diskused" : "2391M", "ip" : "51.91.152.238", "domain" : "indzillawebservices.com", "has_backup" : 0, "disklimit" : "10000M", "maxlst" : "unlimited", "email" : "niraj4u22@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "24 May 01 23:35", "child_nodes" : [], "unix_startdate" : 1714586747, "owner" : "root", "suspendtime" : 1772339469, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 29344 }, { "diskused" : "825M", "suspendreason" : "not suspended", "domain" : "sastngo.org", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "sastngo", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "unlimited", "uid" : "2577", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 60088, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1764158434, "child_nodes" : [], "startdate" : "25 Nov 26 17:30", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "justsolar.in", "suspendreason" : "not suspended", "diskused" : "251M", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2839", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "unlimited", "user" : "justsolar", "plan" : "apkquest_1gb", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "apkquest", "max_email_per_hour" : "25", "inodesused" : 17018, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "1024M", "maxlst" : "unlimited", "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "startdate" : "26 Apr 05 05:43", "child_nodes" : [], "unix_startdate" : 1775347998 }, { "plan" : "hhtechsolution_H_Basic", "user" : "mercyonmecharita", "outgoing_mail_suspended" : 0, "backup" : 1, "maxsql" : "1", "uid" : "2890", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "5", "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "mercyonmecharitabletrust.com", "ip" : "51.91.152.238", "diskused" : "4M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "unix_startdate" : 1778254615, "child_nodes" : [], "startdate" : "26 May 08 21:06", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "250M", "inodesused" : 163, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/usr/local/cpanel/bin/noshell", "suspendtime" : 0, "owner" : "hhtechsolution" }, { "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "492M", "suspendreason" : "not suspended", "domain" : "mspvtiti.online", "ip" : "51.91.152.238", "maxpop" : "5", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "20", "uid" : "1553", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500mb", "user" : "mspvtonline", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 14830, "max_email_per_hour" : "25", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1748775391, "startdate" : "25 Jun 01 16:26", "child_nodes" : [] }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "smartjyotish.in", "suspendreason" : "not suspended", "diskused" : "42M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1299", "maxsql" : "1", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "5", "user" : "smartinjyotish", "plan" : "websbook_linux_500mb_smartinjyotish", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "unlimited", "inodesused" : 1292, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "child_nodes" : [], "startdate" : "19 Feb 21 17:47", "unix_startdate" : 1550751454 }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 13139, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "25 May 28 14:51", "child_nodes" : [], "unix_startdate" : 1748424061, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "336M", "domain" : "sasfoundationngo.org", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "sasfoundationngo", "plan" : "winggolearning_raj", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2424", "theme" : "jupiter" }, { "diskused" : "23M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "signorahygienecareservice.com", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "hhtechsolution_H_Basic", "user" : "signorahygieneca", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2661", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 569, "owner" : "hhtechsolution", "suspendtime" : 0, "unix_startdate" : 1664535313, "child_nodes" : [], "startdate" : "22 Sep 30 16:25", "has_backup" : 0, "disklimit" : "250M", "partition" : "home2", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1" }, { "user" : "aarvfoundationtr", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2791", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "ip" : "51.254.16.113", "domain" : "aarvfoundationtrust.in", "suspendreason" : "not suspended", "diskused" : "1240M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "child_nodes" : [], "startdate" : "26 Feb 24 17:22", "unix_startdate" : 1771933950, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "max_email_per_hour" : "25", "inodesused" : 67473, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1403", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "thesunda_4gbcinemehta", "user" : "cinemehta", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "cinemehta.in", "diskused" : "2634M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "4096M", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "sacretcode@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1605632706, "child_nodes" : [], "startdate" : "20 Nov 17 22:35", "suspendtime" : 0, "owner" : "thesunda", "max_email_per_hour" : "25", "inodesused" : 37392, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "topweblogic_Silver Package", "user" : "cosmittix", "legacy_backup" : 1, "maxpop" : "10", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxsql" : "2", "uid" : "2116", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "diskused" : "658M", "suspendreason" : "not suspended", "domain" : "cosmittix.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1727336039, "startdate" : "24 Sep 26 13:03", "child_nodes" : [], "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "25", "disklimit" : "1000M", "has_backup" : 0, "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 17912, "max_email_per_hour" : "25", "owner" : "topweblogic", "suspendtime" : 0 }, { "maxsql" : "unlimited", "uid" : "1471", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "plan" : "royaldiagnosticc_Unlimited", "user" : "hussain", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "hussainbrothers.in", "ip" : "51.91.152.238", "diskused" : "520M", "suspendreason" : "not suspended", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "unix_startdate" : 1707324075, "startdate" : "24 Feb 07 22:11", "child_nodes" : [], "suspendtime" : 0, "owner" : "royaldiagnosticc", "inodesused" : 9162, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "unix_startdate" : 1691075948, "startdate" : "23 Aug 03 20:49", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "3", "has_backup" : 0, "disklimit" : "1000M", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "1", "max_email_per_hour" : "25", "inodesused" : 9537, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "plan" : "websbook_1000 MB Linux", "user" : "mbdkendra", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "1210", "maxsql" : "2", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "mbdkendra.in", "diskused" : "409M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0" }, { "max_email_per_hour" : "25", "inodesused" : 55874, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1742906018, "child_nodes" : [], "startdate" : "25 Mar 25 18:03", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "ip" : "51.254.16.113", "domain" : "iawc.in", "diskused" : "1338M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "plan" : "winggolearning_raj", "user" : "iawc", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2280", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1 }, { "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "26 Apr 28 12:54", "unix_startdate" : 1777361082, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 67543, "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2869", "maxsql" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "mkgwelfarefounda", "plan" : "winggolearning_raj", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1213M", "ip" : "51.254.16.113", "domain" : "mkgwelfarefoundation.in" }, { "theme" : "jupiter", "uid" : "1183", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "5", "plan" : "websbook_Linux_100mb", "user" : "jnmahavi", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "jnmahavidyalaya.org.in", "diskused" : "164M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "disklimit" : "200M", "has_backup" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "unix_startdate" : 1383370526, "startdate" : "13 Nov 02 11:05", "child_nodes" : [], "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "unlimited", "inodesused" : 1645, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 239, "owner" : "root", "suspendtime" : 0, "startdate" : "24 Mar 01 21:55", "child_nodes" : [], "unix_startdate" : 1709310358, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "rahat786007@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "suspendreason" : "not suspended", "diskused" : "8M", "ip" : "51.91.152.238", "domain" : "superbnb.club", "maxparked" : "unlimited", "maxaddons" : "4", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "superbnb", "plan" : "RED13HOSTING", "max_defer_fail_percentage" : "1", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1053", "maxsql" : "unlimited" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "gramutthaan", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2261", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "diskused" : "938M", "suspendreason" : "not suspended", "domain" : "gramutthaan.org", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1727698399, "child_nodes" : [], "startdate" : "24 Sep 30 17:43", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 38963, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "diskused" : "929M", "suspendreason" : "not suspended", "domain" : "sanmargsssurguja.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "sanmargsssurguja", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2418", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 43611, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1737639419, "child_nodes" : [], "startdate" : "25 Jan 23 19:06", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2230", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "destitutewelfare", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1054M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "destitutewelfaretrust.in", "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1736239570, "startdate" : "25 Jan 07 14:16", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 50302 }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "mithilafarm", "plan" : "root_raj", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2550", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "517M", "domain" : "mithilafarmmakhana.com", "ip" : "51.254.16.113", "maxaddons" : "5", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "child_nodes" : [], "startdate" : "23 Jan 17 17:08", "unix_startdate" : 1673955484, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "disklimit" : "10000M", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 15435, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2313", "maxsql" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "legalkamkaz", "plan" : "winggolearning_raj", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "345M", "ip" : "51.254.16.113", "domain" : "legalkamkaz.com", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "25 Aug 05 16:15", "child_nodes" : [], "unix_startdate" : 1754390753, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 13048 }, { "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "26 Jan 29 13:56", "unix_startdate" : 1769675161, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 67839, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2756", "maxsql" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "wroffer", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "818M", "ip" : "51.254.16.113", "domain" : "wroffer.in" }, { "plan" : "websbook_linux_500mb", "user" : "parakhchhattisga", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "1228", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "domain" : "parakhchhattisgarh.org.in", "ip" : "51.91.152.238", "diskused" : "83M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "unix_startdate" : 1567572524, "child_nodes" : [], "startdate" : "19 Sep 04 10:18", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0, "inodesused" : 2729, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook" }, { "user" : "rmctjaipur", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2396", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "ip" : "51.254.16.113", "domain" : "rmctjaipur.org", "suspendreason" : "not suspended", "diskused" : "983M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "child_nodes" : [], "startdate" : "25 May 14 16:20", "unix_startdate" : 1747219827, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "max_email_per_hour" : "25", "inodesused" : 47201, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "domain" : "sbdsladderoflife.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "809M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "user" : "sbdsladderoflife", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2744", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "inodesused" : 66901, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "26 Jan 17 12:48", "child_nodes" : [], "unix_startdate" : 1768634282, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0 }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 46030, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1773139597, "startdate" : "26 Mar 10 16:16", "child_nodes" : [], "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "diskused" : "1003M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "jivanjyotashram.org", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "jivanjyotashram", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2806", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited" }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "domain" : "prerakjivanfoundation.in", "ip" : "51.254.16.113", "diskused" : "859M", "suspendreason" : "not suspended", "uid" : "2384", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "plan" : "winggolearning_raj", "user" : "prerakjivan", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 30945, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1715940903, "startdate" : "24 May 17 15:45", "child_nodes" : [] }, { "suspendtime" : 0, "owner" : "livechen", "max_email_per_hour" : "unlimited", "inodesused" : 23520, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home", "outgoing_mail_hold" : 0, "email" : "chennaiwebstore@gmail.com", "maxlst" : "unlimited", "unix_startdate" : 1618445703, "startdate" : "21 Apr 15 05:45", "child_nodes" : [], "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "unlimited", "maxaddons" : "unlimited", "ip" : "51.91.152.238", "domain" : "site2.chennaiwebstores.com", "diskused" : "2396M", "suspendreason" : "not suspended", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1300", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "livechen_Unlimitted", "user" : "site2", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "moderndiagnostic.in", "diskused" : "367M", "suspendreason" : "not suspended", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1483", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "royaldiagnosticc_Unlimited plan", "user" : "moderndiagn", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "royaldiagnosticc", "max_email_per_hour" : "unlimited", "inodesused" : 24499, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1713590386, "startdate" : "24 Apr 20 10:49", "child_nodes" : [] }, { "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "869M", "ip" : "51.254.16.113", "domain" : "intrinsichope.org", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2696", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "intrinsichope", "plan" : "winggolearning_raj", "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 36431, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "25 Dec 11 17:06", "unix_startdate" : 1765453017 }, { "user" : "gyantech", "plan" : "RED91SSD", "backup" : 1, "outgoing_mail_suspended" : 1, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1989", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "domain" : "gyantech.live", "ip" : "51.91.152.238", "suspendreason" : "Overdue on Payment", "diskused" : "4715M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "unlimited", "child_nodes" : [], "startdate" : "25 Sep 17 13:34", "unix_startdate" : 1758096251, "maxsub" : "unlimited", "suspended" : 1, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "workboatmedia@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 86272, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 1772771406, "owner" : "root" }, { "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "129M", "ip" : "51.91.152.238", "domain" : "topsiproduct.com", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "2672", "maxsql" : "1", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "topsiproduct", "plan" : "hhtechsolution_H_Basic", "owner" : "hhtechsolution", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 594, "disklimit" : "250M", "has_backup" : 0, "maxlst" : "unlimited", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "startdate" : "23 Jun 09 15:11", "child_nodes" : [], "unix_startdate" : 1686303661 }, { "inodesused" : 44947, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "25 Jul 22 14:58", "child_nodes" : [], "unix_startdate" : 1753176529, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "domain" : "shrirayabahuuddeshiyasamajiksanstha.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "922M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "user" : "shrirayabahuudde", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2453", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [] }, { "theme" : "jupiter", "uid" : "2495", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "winggolearning_raj", "user" : "vijayfoundation", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "vijayfoundation.net.in", "diskused" : "1043M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1722339939, "child_nodes" : [], "startdate" : "24 Jul 30 17:15", "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 39532, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "plan" : "websbook_linux_500mb", "user" : "jharkhandamvsorg", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "1", "uid" : "2763", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "20", "domain" : "jharkhandamvs.org.in", "ip" : "51.91.152.238", "diskused" : "17M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "unix_startdate" : 1769861579, "startdate" : "26 Jan 31 17:42", "child_nodes" : [], "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "inodesused" : 290, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook" }, { "domain" : "skicallahabad.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "201M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "skicallahabad", "plan" : "apkquest_250mb", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "5", "max_emailacct_quota" : "unlimited", "uid" : "1377", "maxsql" : "10", "theme" : "jupiter", "maxpop" : "15", "legacy_backup" : 1, "max_defer_fail_percentage" : "10", "ipv6" : [], "inodesused" : 2234, "max_email_per_hour" : "50", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "apkquest", "startdate" : "24 Oct 03 09:48", "child_nodes" : [], "unix_startdate" : 1727929104, "maxsub" : "10", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "5", "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "partition" : "home2", "disklimit" : "250M", "has_backup" : 0 }, { "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1603M", "domain" : "anticorruptionandcrimecontrolcell.com", "ip" : "51.254.16.113", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2737", "maxsql" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "anticorruptionan", "plan" : "winggolearning_raj", "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 66872, "max_email_per_hour" : "25", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "26 Jan 08 16:59", "unix_startdate" : 1767871788 }, { "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "10", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "2825", "maxsql" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "kampfrichterpvtl", "plan" : "topweblogic_Gold Package", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "3M", "ip" : "51.91.152.238", "domain" : "kampfrichterpvtltd.com", "disklimit" : "2000M", "has_backup" : 0, "maxlst" : "25", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "topweblogic@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "child_nodes" : [], "startdate" : "26 Mar 24 18:03", "unix_startdate" : 1774355610, "owner" : "topweblogic", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 351 }, { "disklimit" : "10000M", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "rudramtech.solutions@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1703860013, "startdate" : "23 Dec 29 19:56", "child_nodes" : [], "owner" : "root", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 12285, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "1529", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 1, "plan" : "Red91Solid", "user" : "deslatur", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "1407M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "deslatur.org" }, { "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "139M", "ip" : "51.91.152.238", "domain" : "hanujaprint.com", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "10", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "2613", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "hanujaprint", "plan" : "hhtechsolution_H_Adv", "owner" : "hhtechsolution", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 983, "has_backup" : 0, "disklimit" : "1500M", "maxlst" : "1", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "child_nodes" : [], "startdate" : "24 Sep 19 07:50", "unix_startdate" : 1726712453 }, { "unix_startdate" : 1775130686, "child_nodes" : [], "startdate" : "26 Apr 02 17:21", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 67556, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "vbpfoundation", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2834", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "diskused" : "911M", "suspendreason" : "not suspended", "domain" : "vbpfoundation.org", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "domain" : "hhshmscomplex.com", "ip" : "51.91.152.238", "diskused" : "189M", "suspendreason" : "not suspended", "maxsql" : "1", "uid" : "2614", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "10", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "plan" : "hhtechsolution_H_Adv", "user" : "hhshmscomplex", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 6446, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "1", "disklimit" : "1500M", "has_backup" : 0, "unix_startdate" : 1658569045, "startdate" : "22 Jul 23 15:07", "child_nodes" : [] }, { "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1760183337, "child_nodes" : [], "startdate" : "25 Oct 11 17:18", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 44376, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "uid" : "2528", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "drtilgamwelfare", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "938M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "drtilgamwelfarefoundation.in" }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "rajnarayanpandeypgcollege.com", "diskused" : "70M", "suspendreason" : "not suspended", "theme" : "jupiter", "maxsql" : "1", "uid" : "1248", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "plan" : "websbook_linux_500mb", "user" : "rajnaray", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 1971, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "unix_startdate" : 1362236482, "child_nodes" : [], "startdate" : "13 Mar 02 20:31" }, { "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2786", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "ateriyasbeautyca", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "948M", "domain" : "ateriyasbeautycareandsaloonassociation.org", "ip" : "51.254.16.113", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "26 Feb 21 10:46", "child_nodes" : [], "unix_startdate" : 1771651010, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 45448, "max_email_per_hour" : "25" }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 47065, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1748956259, "child_nodes" : [], "startdate" : "25 Jun 03 18:40", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "srpswt.org", "diskused" : "1064M", "suspendreason" : "not suspended", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2464", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "winggolearning_raj", "user" : "srpswt", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "maxsql" : "unlimited", "uid" : "1409", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "default", "user" : "grillshriram", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1397M", "suspendreason" : "not suspended", "domain" : "shriramgrill.in", "ip" : "51.91.152.238", "outgoing_mail_hold" : 0, "email" : "sacretcode@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1635428849, "startdate" : "21 Oct 28 19:17", "child_nodes" : [], "owner" : "thesunda", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 52107, "max_email_per_hour" : "*unknown*" }, { "disklimit" : "20480M", "has_backup" : 0, "email" : "knacktraders001@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 1, "maxsub" : "unlimited", "unix_startdate" : 1668705448, "child_nodes" : [], "startdate" : "22 Nov 17 22:47", "owner" : "root", "suspendtime" : 1764658202, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 15144, "ipv6" : [], "max_defer_fail_percentage" : "10", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2538", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 1, "plan" : "Red92Solid", "user" : "hamerpow", "maxaddons" : "1", "maxparked" : "unlimited", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "450M", "suspendreason" : "Overdue on Payment", "ip" : "51.91.152.238", "domain" : "hamerpower.in" }, { "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "944M", "domain" : "sadhawieducationfoundation.in", "ip" : "51.254.16.113", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2404", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "sadhawieducation", "plan" : "winggolearning_raj", "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 45556, "max_email_per_hour" : "25", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "25 Jul 03 17:59", "child_nodes" : [], "unix_startdate" : 1751545743 }, { "max_email_per_hour" : "25", "inodesused" : 24251, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "apkquest", "unix_startdate" : 1772879929, "startdate" : "26 Mar 07 16:08", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "3072M", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "maxlst" : "unlimited", "ip" : "51.91.152.238", "domain" : "api.onlinesteno.in", "diskused" : "2249M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "plan" : "apkquest_3gb", "user" : "apionlinesteno", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2802", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 0 }, { "plan" : "winggolearning_raj", "user" : "arabiaislamia", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "2183", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.254.16.113", "domain" : "arabiaislamiaeducationfoundation.in", "diskused" : "943M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "unix_startdate" : 1733319468, "startdate" : "24 Dec 04 19:07", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 36277, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning" }, { "owner" : "apkquest", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "50", "inodesused" : 12, "disklimit" : "250M", "has_backup" : 0, "maxlst" : "5", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "shiv2144@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "10", "child_nodes" : [], "startdate" : "24 Sep 03 03:47", "unix_startdate" : 1725315440, "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1602M", "ip" : "51.91.152.238", "domain" : "adventsoftwares.com", "ipv6" : [], "max_defer_fail_percentage" : "10", "maxpop" : "15", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "5", "max_emailacct_quota" : "unlimited", "uid" : "1350", "maxsql" : "10", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "adventsoftwares", "plan" : "apkquest_250mb" }, { "unix_startdate" : 1761372638, "child_nodes" : [], "startdate" : "25 Oct 25 11:40", "inodeslimit" : "unlimited", "suspended" : 1, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "50200M", "email" : "saritakumarilkp@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "max_email_per_hour" : "unlimited", "inodesused" : 10099, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 1761551734, "owner" : "filmywap", "plan" : "undefined", "user" : "filmywap", "backup" : 1, "outgoing_mail_suspended" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2539", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "unlimited", "ip" : "51.91.152.238", "domain" : "filmy4wap.wtf", "diskused" : "3473M", "suspendreason" : "Overdue on Payment", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "unlimited", "maxparked" : "unlimited" }, { "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 45757, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1754636435, "startdate" : "25 Aug 08 12:30", "child_nodes" : [], "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "everlifecharitabletrust.org", "ip" : "51.254.16.113", "diskused" : "953M", "suspendreason" : "not suspended", "uid" : "2248", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "plan" : "winggolearning_raj", "user" : "everlifecharitab", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "child_nodes" : [], "startdate" : "22 Jun 13 00:34", "unix_startdate" : 1655060690, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "max_email_per_hour" : "25", "inodesused" : 1482, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "user" : "jnicorg", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1182", "maxsql" : "1", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "ip" : "51.91.152.238", "domain" : "jnic.org.in", "suspendreason" : "not suspended", "diskused" : "79M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 2487, "owner" : "websbook", "suspendtime" : 0, "unix_startdate" : 1362211646, "child_nodes" : [], "startdate" : "13 Mar 02 13:37", "disklimit" : "500M", "has_backup" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "diskused" : "309M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "bgpspgc.org.in", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "balgovin", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "1", "uid" : "1103", "maxftp" : "1", "max_emailacct_quota" : "unlimited" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "default", "user" : "adsfreeclassi", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "uid" : "2105", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "1086M", "suspendreason" : "not suspended", "domain" : "adsfreeclassifieds.in", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1456910946, "child_nodes" : [], "startdate" : "16 Mar 02 14:59", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "adsfreeclassifieds@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 45279, "max_email_per_hour" : "*unknown*", "owner" : "topweblogic", "suspendtime" : 0 }, { "owner" : "hhtechsolution", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 1361, "has_backup" : 0, "disklimit" : "250M", "maxlst" : "unlimited", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "startdate" : "24 Mar 29 11:01", "child_nodes" : [], "unix_startdate" : 1711690292, "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "142M", "ip" : "51.91.152.238", "domain" : "ibsfa.com", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "2620", "maxsql" : "1", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "ibsfa", "plan" : "hhtechsolution_H_Basic" }, { "startdate" : "23 Mar 03 21:48", "child_nodes" : [], "unix_startdate" : 1677860289, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "ashiqulrahman175@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 43941, "owner" : "royaldiagnosticc", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "royaldiagnosticc", "plan" : "RED33RESELLER", "max_defer_fail_percentage" : "100", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1461", "maxsql" : "unlimited", "suspendreason" : "not suspended", "diskused" : "585M", "ip" : "51.91.152.238", "domain" : "royaldiagnostic.co.in", "maxaddons" : "unlimited", "maxparked" : "unlimited", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0 }, { "unix_startdate" : 1557136088, "startdate" : "19 May 06 15:18", "child_nodes" : [], "has_backup" : 0, "disklimit" : "500M", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 1322, "owner" : "websbook", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "daynighthelping", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "1", "uid" : "1133", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "diskused" : "46M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "daynighthelping.com", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1735307569, "startdate" : "24 Dec 27 19:22", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 36382, "max_email_per_hour" : "25", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2179", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "aniketeducationa", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "911M", "suspendreason" : "not suspended", "domain" : "aniketeducationalewamwelfaresociety.in", "ip" : "51.254.16.113" }, { "ip" : "51.254.16.113", "domain" : "abrsocialfoundation.in", "diskused" : "914M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "plan" : "winggolearning_raj", "user" : "abrsocialfoundat", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "2163", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 44764, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1753449019, "startdate" : "25 Jul 25 18:40", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_2000mb", "user" : "missioninstitute", "maxpop" : "10", "legacy_backup" : 0, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxsql" : "2", "uid" : "1595", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "582M", "suspendreason" : "not suspended", "domain" : "missioninstituteprayagraj.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1749025108, "startdate" : "25 Jun 04 13:48", "child_nodes" : [], "email" : "*unknown*", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "10", "disklimit" : "2000M", "has_backup" : 0, "maxsub" : "10", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 29069, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0 }, { "domain" : "garveyafricainstitute.co.za", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "5226M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "garveyafricainst", "plan" : "topweblogic_Silver Package_garveyafricainst_garvey…_garveyafricainst", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "2", "uid" : "2124", "theme" : "jupiter", "maxpop" : "10", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "inodesused" : 43857, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "topweblogic", "startdate" : "20 Feb 19 15:10", "child_nodes" : [], "unix_startdate" : 1582105251, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "25", "outgoing_mail_hold" : 0, "email" : "topweblogic@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "6000M" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "topweblogic_Silver Package", "user" : "webzonetechnolog", "maxpop" : "10", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "uid" : "2147", "maxsql" : "2", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "diskused" : "24M", "suspendreason" : "not suspended", "domain" : "webzonetechnologies.co", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1592449713, "startdate" : "20 Jun 18 08:38", "child_nodes" : [], "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "25", "has_backup" : 0, "disklimit" : "1000M", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 141, "max_email_per_hour" : "25", "owner" : "topweblogic", "suspendtime" : 0 }, { "maxlst" : "unlimited", "email" : "joshi.ravij@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "disklimit" : "10000M", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "24 Feb 23 12:21", "child_nodes" : [], "unix_startdate" : 1708671063, "owner" : "root", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 187463, "max_email_per_hour" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1541", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "ladylife", "plan" : "Red91Solid", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "4309M", "domain" : "ladylifeboutique.in", "ip" : "51.91.152.238" }, { "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 70240, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "startdate" : "26 Mar 28 15:44", "child_nodes" : [], "unix_startdate" : 1774692875, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "jivranfoundation.org", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1278M", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2826", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "jivranfoundation", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 20452, "max_email_per_hour" : "*unknown*", "owner" : "topweblogic", "suspendtime" : 0, "unix_startdate" : 1682675722, "child_nodes" : [], "startdate" : "23 Apr 28 15:25", "outgoing_mail_hold" : 0, "email" : "topweblogic@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "570M", "suspendreason" : "not suspended", "domain" : "alizahomedecor.co.in", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "default", "user" : "alizahomedecor", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "uid" : "2104", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter" }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "webnationhost.com", "ip" : "51.91.152.238", "diskused" : "51M", "suspendreason" : "not suspended", "maxsql" : "15", "uid" : "1552", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "30", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "plan" : "websbook_Unlimited Linux", "user" : "webnationhost", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 760, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home2", "maxlst" : "0", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1748613782, "startdate" : "25 May 30 19:33", "child_nodes" : [] }, { "plan" : "websbook_linux_500mb", "user" : "vaseraorg", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "1", "uid" : "1327", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "domain" : "vasera.org.in", "ip" : "51.91.152.238", "diskused" : "20M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "unix_startdate" : 1627898327, "startdate" : "21 Aug 02 15:28", "child_nodes" : [], "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0, "inodesused" : 3134, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook" }, { "unix_startdate" : 1668040585, "startdate" : "22 Nov 10 06:06", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 1656, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "livechen", "plan" : "default", "user" : "ecomch", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "1149", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "domain" : "ecom.chennaiwebstores.com", "ip" : "51.91.152.238", "diskused" : "47M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "unlimited", "maxparked" : "unlimited" }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "ncsrenukoot.org", "ip" : "51.91.152.238", "diskused" : "1459M", "suspendreason" : "not suspended", "uid" : "1370", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "apkquest_2gb", "user" : "ncsrenukoot", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "apkquest", "inodesused" : 6666, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "2048M", "unix_startdate" : 1727927896, "startdate" : "24 Oct 03 09:28", "child_nodes" : [] }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "startdate" : "25 Feb 25 15:38", "child_nodes" : [], "unix_startdate" : 1740478114, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 46408, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2426", "maxsql" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "user" : "satyanandss", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "satyanandss.org.in", "suspendreason" : "not suspended", "diskused" : "962M" }, { "startdate" : "25 Mar 24 12:16", "child_nodes" : [], "unix_startdate" : 1742798789, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 46600, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "user" : "ahmadsewasanstha", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2172", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "ahmadsewasanstha.org", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1007M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1" }, { "owner" : "topweblogic", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 23744, "max_email_per_hour" : "25", "maxlst" : "25", "email" : "topweblogic@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "disklimit" : "1100M", "has_backup" : 0, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "26 Jan 19 15:02", "unix_startdate" : 1768815166, "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1103M", "domain" : "aquasteam.co.za", "ip" : "51.91.152.238", "legacy_backup" : 0, "maxpop" : "10", "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "2", "maxsql" : "2", "uid" : "2750", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "aquasteam", "plan" : "default" }, { "user" : "lokngokalyan", "plan" : "winggolearning_raj_lokngokalyan", "backup" : 1, "outgoing_mail_suspended" : 0, "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2318", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "100", "domain" : "lokkalyan.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1062M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "child_nodes" : [], "startdate" : "25 May 29 17:45", "unix_startdate" : 1748520907, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "10240M", "has_backup" : 0, "inodesused" : 47011, "max_email_per_hour" : "50", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 64397, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "26 Jan 02 13:59", "child_nodes" : [], "unix_startdate" : 1767342581, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "797M", "domain" : "sarvodyamsewafoundation.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "sarvodyamsewafou", "plan" : "winggolearning_raj", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2729", "theme" : "jupiter" }, { "theme" : "jupiter", "maxsql" : "20", "uid" : "2886", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 0, "plan" : "otiyahos_ECO", "user" : "nouvelangle", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "10", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "nouvelangle.tg", "diskused" : "15262M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "100000M", "email" : "agenceotiya@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1777907341, "child_nodes" : [], "startdate" : "26 May 04 20:39", "suspendtime" : 0, "owner" : "otiyahos", "max_email_per_hour" : "25", "inodesused" : 31896, "mailbox_format" : "maildir", "shell" : "/usr/local/cpanel/bin/noshell" }, { "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2624", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "hhtechsolution_H_Basic", "user" : "instacpneumatics", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "133M", "suspendreason" : "not suspended", "domain" : "instacpneumatics.com", "ip" : "51.91.152.238", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "250M", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1667986330, "child_nodes" : [], "startdate" : "22 Nov 09 15:02", "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1040, "max_email_per_hour" : "25" }, { "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1645963299, "child_nodes" : [], "startdate" : "22 Feb 27 17:31", "owner" : "topweblogic", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 206722, "max_email_per_hour" : "*unknown*", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "maxsql" : "unlimited", "uid" : "2109", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "default", "user" : "bahadarpur", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "2063M", "suspendreason" : "not suspended", "domain" : "bahadarpur.org", "ip" : "51.91.152.238" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "shujishikshan", "plan" : "winggolearning_raj", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2455", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "1424M", "domain" : "shrisudhanshujishikshansansthan.org.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "child_nodes" : [], "startdate" : "25 Aug 06 19:32", "unix_startdate" : 1754488960, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 59884, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "bhagirathsinhfou", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2199", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "923M", "suspendreason" : "not suspended", "domain" : "bhagirathsinhfoundation.org", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1753256915, "startdate" : "25 Jul 23 13:18", "child_nodes" : [], "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 45263, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "owner" : "root", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "50", "inodesused" : 12769, "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "aashika6576@gmail.com", "partition" : "home", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1546851466, "startdate" : "19 Jan 07 14:27", "child_nodes" : [], "maxparked" : "unlimited", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "157M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "website.gen.in", "max_defer_fail_percentage" : "100", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1075", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "RED31RESELLER", "user" : "websiteg" }, { "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "26 Apr 15 12:30", "unix_startdate" : 1776236429, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 68837, "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2857", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "rtfbdfhrt6fdbdf", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "872M", "ip" : "51.254.16.113", "domain" : "jeevsankalp.org" }, { "inodesused" : 57596, "max_email_per_hour" : "500", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 1748500218, "owner" : "root", "unix_startdate" : 1744275613, "startdate" : "25 Apr 10 14:30", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 1, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "domain" : "coursyfy.com", "ip" : "51.91.152.238", "diskused" : "717M", "suspendreason" : "Overdue on Payment", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "unlimited", "plan" : "Economy", "user" : "coursyfy", "outgoing_mail_suspended" : 1, "backup" : 1, "uid" : "1527", "maxsql" : "10", "maxftp" : "50", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "100", "max_defer_fail_percentage" : "unlimited", "ipv6" : [] }, { "user" : "balmaha", "plan" : "websbook_linux_2000mb", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1104", "maxsql" : "2", "theme" : "jupiter", "maxpop" : "10", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "domain" : "balrammahavidyalaya.org", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "263M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "startdate" : "13 Mar 02 20:25", "child_nodes" : [], "unix_startdate" : 1362236144, "maxsub" : "10", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "10", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "has_backup" : 0, "disklimit" : "2000M", "inodesused" : 2976, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook" }, { "max_email_per_hour" : "25", "inodesused" : 67279, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1773833451, "startdate" : "26 Mar 18 17:00", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "ip" : "51.254.16.113", "domain" : "jamiaalquranfoundation.in", "diskused" : "1357M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "plan" : "winggolearning_raj", "user" : "jamiaalquranfoun", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "2818", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "default", "user" : "wwebsite", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "maxsql" : "unlimited", "uid" : "2149", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "1673M", "suspendreason" : "not suspended", "domain" : "websitedesignjoburg.co.za", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1500548608, "startdate" : "17 Jul 20 16:33", "child_nodes" : [], "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "superalloydarkshine04@gmail.com, superalloydarkshine04@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 42095, "max_email_per_hour" : "*unknown*", "owner" : "topweblogic", "suspendtime" : 0 }, { "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "0", "uid" : "1304", "maxsql" : "1", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "smtjpdsmv", "plan" : "websbook_Linux_100mb", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "85M", "domain" : "smtjpdsmv.org", "ip" : "51.91.152.238", "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "disklimit" : "200M", "has_backup" : 0, "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "16 Oct 27 10:51", "unix_startdate" : 1477545675, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 1461, "max_email_per_hour" : "unlimited" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1470, "max_email_per_hour" : "unlimited", "owner" : "websbook", "suspendtime" : 0, "unix_startdate" : 1381382605, "startdate" : "13 Oct 10 10:53", "child_nodes" : [], "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "0", "has_backup" : 0, "disklimit" : "200M", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "68M", "suspendreason" : "not suspended", "domain" : "gulabsinghmahilamahavidyalaya.org", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_Linux_100mb", "user" : "gulabsin", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxsql" : "1", "uid" : "1163", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "theme" : "jupiter" }, { "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 35949, "max_email_per_hour" : "25", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "26 Jan 30 12:06", "unix_startdate" : 1769755014, "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "944M", "domain" : "hmf.org.in", "ip" : "51.254.16.113", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2762", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "hmf", "plan" : "winggolearning_raj" }, { "suspendtime" : 0, "owner" : "apkquest", "max_email_per_hour" : "unlimited", "inodesused" : 9, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "512M", "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1727928376, "child_nodes" : [], "startdate" : "24 Oct 03 09:36", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "nsvallahabad.com", "diskused" : "2389M", "suspendreason" : "not suspended", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1371", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "apkquest_512mb", "user" : "nsvallahabad", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "hhtechsolution_H_Adv", "user" : "rvsholidays", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "10", "legacy_backup" : 0, "theme" : "jupiter", "uid" : "2799", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "diskused" : "412M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "rvsholidays.com", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1772445143, "startdate" : "26 Mar 02 15:22", "child_nodes" : [], "disklimit" : "1500M", "has_backup" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 1233, "owner" : "hhtechsolution", "suspendtime" : 0 }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "policepublicpres", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2378", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "diskused" : "1141M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "policepublicpressarmy.in", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1754396119, "startdate" : "25 Aug 05 17:45", "child_nodes" : [], "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 49983, "owner" : "winggolearning", "suspendtime" : 0 }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "10", "domain" : "radiodjena.tg", "ip" : "51.91.152.238", "diskused" : "834M", "suspendreason" : "not suspended", "uid" : "2882", "maxsql" : "20", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "otiyahos_ECO", "user" : "radiodjena", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "otiyahos", "inodesused" : 162, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/usr/local/cpanel/bin/noshell", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "agenceotiya@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "100000M", "has_backup" : 0, "unix_startdate" : 1777878989, "child_nodes" : [], "startdate" : "26 May 04 12:46" }, { "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 44849, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1733221862, "child_nodes" : [], "startdate" : "24 Dec 03 16:01", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "bitsysocialorganization.in", "ip" : "51.254.16.113", "diskused" : "925M", "suspendreason" : "not suspended", "uid" : "2206", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "plan" : "winggolearning_raj", "user" : "bitsysocial", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "suspendtime" : 0, "owner" : "websbook", "inodesused" : 27718, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "0", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1613972661, "startdate" : "21 Feb 22 11:14", "child_nodes" : [], "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "domain" : "expressionjournal.com", "ip" : "51.91.152.238", "diskused" : "2239M", "suspendreason" : "not suspended", "uid" : "1150", "maxsql" : "15", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "30", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "websbook_Unlimited Linux", "user" : "expressionjourna", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "mahiaquaservices", "plan" : "websbook_linux_500mb", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1205", "maxsql" : "1", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "83M", "domain" : "mahiaquaservices.com", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "startdate" : "21 Oct 01 23:18", "child_nodes" : [], "unix_startdate" : 1633110480, "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 2833, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0 }, { "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1755091382, "child_nodes" : [], "startdate" : "25 Aug 13 18:53", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 12593, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2367", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "pacsfed", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "350M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "pacsfed.in" }, { "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "topweblogic@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "19 Feb 09 13:48", "child_nodes" : [], "unix_startdate" : 1549700290, "owner" : "topweblogic", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "*unknown*", "inodesused" : 42300, "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2126", "maxsql" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "hindubrahminserv", "plan" : "default", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1250M", "ip" : "51.91.152.238", "domain" : "hindubrahminservice.com" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 56097, "owner" : "otiyaho2", "suspendtime" : 0, "unix_startdate" : 1684487085, "startdate" : "23 May 19 14:34", "child_nodes" : [], "disklimit" : "unlimited", "has_backup" : 0, "email" : "togolais2008@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "diskused" : "14874M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "sokashipping.com", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "default", "user" : "sokashipping", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1543", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "RED12HOSTING", "user" : "he2editinxcom", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "5", "ipv6" : [], "maxsql" : "unlimited", "uid" : "1546", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "diskused" : "39507M", "suspendreason" : "not suspended", "domain" : "he2editing.com", "ip" : "51.91.152.238", "maxparked" : "unlimited", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1729842439, "startdate" : "24 Oct 25 13:17", "child_nodes" : [], "email" : "chaudharihiten21@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 16982, "max_email_per_hour" : "25", "owner" : "root", "suspendtime" : 0 }, { "suspendreason" : "Overdue on Payment", "diskused" : "1M", "ip" : "51.91.152.238", "domain" : "trivenievents.com", "maxaddons" : "5", "maxparked" : "5", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 1, "user" : "trivenievents", "plan" : "dnsscom_afilmywap", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2579", "maxsql" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 100, "owner" : "dnsscom", "suspendtime" : 1765953021, "startdate" : "25 Dec 02 12:21", "child_nodes" : [], "unix_startdate" : 1764658315, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "sachinking151@hotmail.com", "partition" : "home2", "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited" }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "startdate" : "26 Mar 31 17:15", "child_nodes" : [], "unix_startdate" : 1774957555, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 67726, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2830", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "user" : "dhammachetnaabhi", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "dhammachetnaabhiyantrust.co.in", "suspendreason" : "not suspended", "diskused" : "1313M" }, { "unix_startdate" : 1724914257, "startdate" : "24 Aug 29 12:20", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 34848, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "plan" : "winggolearning_raj", "user" : "namamilifecare", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "unlimited", "uid" : "2346", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "namamilifecarefoundation.in", "ip" : "51.254.16.113", "diskused" : "863M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1" }, { "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "sacretcode@gmail.com", "maxlst" : "0", "disklimit" : "1024M", "has_backup" : 0, "unix_startdate" : 1724651888, "startdate" : "24 Aug 26 11:28", "child_nodes" : [], "suspendtime" : 0, "owner" : "thesunda", "inodesused" : 16092, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "uid" : "1414", "maxsql" : "5", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "3", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "thesunda_cine1024", "user" : "konnect", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "konnectawards.in", "ip" : "51.91.152.238", "diskused" : "870M", "suspendreason" : "not suspended" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 58316, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "child_nodes" : [], "startdate" : "25 Dec 11 18:39", "unix_startdate" : 1765458584, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "960M", "domain" : "gautamifoundation.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "gautamifoundatio", "plan" : "winggolearning_raj", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2698", "maxsql" : "unlimited", "theme" : "jupiter" }, { "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "1", "disklimit" : "1000M", "has_backup" : 0, "maxsub" : "3", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1655203462, "startdate" : "22 Jun 14 16:14", "child_nodes" : [], "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 747, "max_email_per_hour" : "25", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "uid" : "1139", "maxsql" : "2", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_1000 MB Linux", "user" : "dossaryes", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "65M", "suspendreason" : "not suspended", "domain" : "dossary-es.com", "ip" : "51.91.152.238" }, { "owner" : "thesunda", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 10650, "has_backup" : 0, "disklimit" : "1024M", "maxlst" : "0", "email" : "sacretcode@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "startdate" : "25 Jul 09 14:18", "child_nodes" : [], "unix_startdate" : 1752050893, "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "343M", "ip" : "51.91.152.238", "domain" : "muddekibaat.in", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "3", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "5", "uid" : "1972", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "muddekibaat", "plan" : "thesunda_cine1024" }, { "user" : "fashion3", "plan" : "RED12HOSTING", "backup" : 1, "outgoing_mail_suspended" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1533", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "5", "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "fashionfusionpost.com", "suspendreason" : "Overdue on Payment", "diskused" : "772M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "unlimited", "startdate" : "23 Dec 09 11:48", "child_nodes" : [], "unix_startdate" : 1702102739, "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "laxmankumar046@gmail.com", "partition" : "home2", "max_email_per_hour" : "25", "inodesused" : 15736, "shell" : "/bin/false", "mailbox_format" : "maildir", "suspendtime" : 1778301007, "owner" : "root" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 44108, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1739974431, "child_nodes" : [], "startdate" : "25 Feb 19 19:43", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "940M", "suspendreason" : "not suspended", "domain" : "poorchildhelpfoundation.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "poorchildhelp", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "unlimited", "uid" : "2379", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter" }, { "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 977, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "child_nodes" : [], "startdate" : "17 Dec 01 14:24", "unix_startdate" : 1512118493, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "radhyasinghsingraurpvtiti.org.in", "suspendreason" : "not suspended", "diskused" : "29M", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1246", "maxsql" : "1", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "user" : "radhyasinghsingr", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "suspendreason" : "not suspended", "diskused" : "1967M", "domain" : "ntsoftechsolutions.com", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "ntsoftechsolutio", "plan" : "apkquest_2gb", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1372", "maxsql" : "unlimited", "theme" : "jupiter", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 94367, "max_email_per_hour" : "25", "owner" : "apkquest", "suspendtime" : 0, "child_nodes" : [], "startdate" : "24 Sep 03 09:43", "unix_startdate" : 1725336801, "maxlst" : "unlimited", "email" : "shiv2144@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "disklimit" : "2048M", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited" }, { "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2726", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "ummidngo", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "929M", "suspendreason" : "not suspended", "domain" : "ummidngo.in", "ip" : "51.254.16.113", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1767103036, "startdate" : "25 Dec 30 19:27", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 44677, "max_email_per_hour" : "25" }, { "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2284", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "user" : "imhopefoundation", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "imhopefoundation.org", "suspendreason" : "not suspended", "diskused" : "930M", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "startdate" : "24 Nov 28 16:07", "child_nodes" : [], "unix_startdate" : 1732790266, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 38674, "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500mb", "user" : "sambhavanamporg", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxsql" : "1", "uid" : "1274", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "diskused" : "34M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "sambhavanamp.org.in", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1715271030, "child_nodes" : [], "startdate" : "24 May 09 21:40", "has_backup" : 0, "disklimit" : "500M", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 1188, "owner" : "websbook", "suspendtime" : 0 }, { "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "30", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1323", "maxsql" : "15", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "thevoicecreative", "plan" : "websbook_Unlimited Linux", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "948M", "ip" : "51.91.152.238", "domain" : "thevoiceofcreativeresearch.com", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "child_nodes" : [], "startdate" : "24 Sep 03 16:11", "unix_startdate" : 1725360092, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 26917 }, { "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 75019, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "startdate" : "25 Oct 14 12:29", "child_nodes" : [], "unix_startdate" : 1760425153, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "mariesahayta.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "6534M", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2530", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "user" : "mariesahayta", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "0", "unix_startdate" : 1666325423, "startdate" : "22 Oct 21 09:40", "child_nodes" : [], "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 7691, "mailbox_format" : "maildir", "shell" : "/bin/bash", "theme" : "jupiter", "maxsql" : "1", "uid" : "1136", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "plan" : "websbook_linux_500mb", "user" : "devcollegepharma", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "devcollegepharmacy.org.in", "diskused" : "195M", "suspendreason" : "not suspended" }, { "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "unix_startdate" : 1757078060, "child_nodes" : [], "startdate" : "25 Sep 05 18:44", "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 45157, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsql" : "unlimited", "uid" : "2443", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "plan" : "winggolearning_raj", "user" : "shineowner", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "shineowner.in", "ip" : "51.254.16.113", "diskused" : "914M", "suspendreason" : "not suspended" }, { "max_email_per_hour" : "25", "inodesused" : 48997, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1703325871, "startdate" : "23 Dec 23 15:34", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "ip" : "51.254.16.113", "domain" : "maagayatrimahilasansthan.in", "diskused" : "795M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "plan" : "winggolearning_raj", "user" : "maagayatri", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2320", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1 }, { "maxparked" : "0", "maxaddons" : "10", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "17791M", "suspendreason" : "not suspended", "domain" : "hilay.tg", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxsql" : "20", "uid" : "1024", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "otiyahos_ECO", "user" : "hilay", "owner" : "otiyahos", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 102538, "max_email_per_hour" : "25", "email" : "togolais2008@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "100000M", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1625487745, "startdate" : "21 Jul 05 17:52", "child_nodes" : [] }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_Unlimited Linux", "user" : "mbdshop", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "30", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1211", "maxsql" : "15", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "diskused" : "6437M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "vikalpwars.online", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1704610897, "startdate" : "24 Jan 07 12:31", "child_nodes" : [], "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 209691, "owner" : "websbook", "suspendtime" : 0 }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "startdate" : "25 Dec 30 19:13", "child_nodes" : [], "unix_startdate" : 1767102211, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 69219, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2725", "maxsql" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "user" : "youngstarparty", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "youngstarparty.in", "suspendreason" : "not suspended", "diskused" : "885M" }, { "max_email_per_hour" : "25", "inodesused" : 30134, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1716963093, "child_nodes" : [], "startdate" : "24 May 29 11:41", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "ip" : "51.254.16.113", "domain" : "sudikshafoundation.in", "diskused" : "909M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "plan" : "winggolearning_raj", "user" : "sudiksha", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "2470", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "harishchandracha", "plan" : "winggolearning_raj", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2265", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "941M", "domain" : "harishchandracharitabletrust.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "child_nodes" : [], "startdate" : "25 Jun 12 17:15", "unix_startdate" : 1749728718, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 44681, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 42184, "owner" : "winggolearning", "suspendtime" : 0, "child_nodes" : [], "startdate" : "24 Dec 17 18:31", "unix_startdate" : 1734440502, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "suspendreason" : "not suspended", "diskused" : "1017M", "ip" : "51.254.16.113", "domain" : "livepundri.in", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "livepundri", "plan" : "winggolearning_raj", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2316", "maxsql" : "unlimited" }, { "has_backup" : 0, "disklimit" : "250M", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "unix_startdate" : 1665982138, "child_nodes" : [], "startdate" : "22 Oct 17 10:18", "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 658, "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxsql" : "1", "uid" : "2670", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "hhtechsolution_H_Basic", "user" : "szenterpriseseur", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "30M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "szenterpriseseureka.com" }, { "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1426", "maxsql" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "prpf", "plan" : "thesunda_500", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "208M", "domain" : "prpf.in", "ip" : "51.91.152.238", "maxlst" : "unlimited", "partition" : "home2", "email" : "sacretcode@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "512M", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "21 Feb 05 20:02", "child_nodes" : [], "unix_startdate" : 1612535526, "owner" : "thesunda", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 10527, "max_email_per_hour" : "25" }, { "domain" : "ifyshoponline.com", "ip" : "51.91.152.238", "suspendreason" : "Overdue on Payment", "diskused" : "130641M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "unlimited", "maxaddons" : "4", "user" : "ifyshopo", "plan" : "RED13HOSTING", "backup" : 1, "outgoing_mail_suspended" : 1, "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1049", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "inodesused" : 334306, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 1774672202, "owner" : "root", "child_nodes" : [], "startdate" : "23 Mar 28 06:55", "unix_startdate" : 1679966734, "maxsub" : "unlimited", "suspended" : 1, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "ifyshoponline1@gmail.com", "partition" : "home", "disklimit" : "unlimited", "has_backup" : 0 }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "disklimit" : "250M", "has_backup" : 0, "maxlst" : "unlimited", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "startdate" : "24 Aug 05 21:18", "child_nodes" : [], "unix_startdate" : 1722872887, "suspendtime" : 0, "owner" : "hhtechsolution", "max_email_per_hour" : "25", "inodesused" : 9, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "2626", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "5", "user" : "jayamstay", "plan" : "hhtechsolution_H_Basic", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "jayamstay.com", "suspendreason" : "not suspended", "diskused" : "733M" }, { "inodesused" : 533, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "child_nodes" : [], "startdate" : "17 Jun 21 06:35", "unix_startdate" : 1498007121, "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "has_backup" : 0, "disklimit" : "200M", "domain" : "rajendrapratapsinghshikshansansthan.org.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "40M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "rpratapsingh", "plan" : "websbook_Linux_100mb", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "0", "max_emailacct_quota" : "unlimited", "uid" : "1266", "maxsql" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "unlimited" }, { "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2730", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "nirbanmukteswari", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "832M", "ip" : "51.254.16.113", "domain" : "nirbanmukteswarimatripith.in", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "26 Jan 03 13:18", "unix_startdate" : 1767426489, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 63372 }, { "theme" : "jupiter", "maxsql" : "20", "uid" : "1596", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 0, "plan" : "otiyahos_ECO", "user" : "humanitasasbl", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "10", "ip" : "51.91.152.238", "domain" : "humanitas-asbl.com", "diskused" : "7482M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "100000M", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "agenceotiya@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1749626376, "child_nodes" : [], "startdate" : "25 Jun 11 12:49", "suspendtime" : 0, "owner" : "otiyahos", "max_email_per_hour" : "25", "inodesused" : 70218, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "250M", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1719498967, "startdate" : "24 Jun 27 20:06", "child_nodes" : [], "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1460, "max_email_per_hour" : "25", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2663", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 1, "backup" : 1, "plan" : "hhtechsolution_H_Basic", "user" : "snmedicalservice", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "136M", "suspendreason" : "not suspended", "domain" : "snmedicalservices.com", "ip" : "51.91.152.238" }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "gpersociety.org.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "61M", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1159", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "user" : "gpersocietyorg", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 1633, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "500M", "startdate" : "20 Dec 21 17:36", "child_nodes" : [], "unix_startdate" : 1608552399 }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "itcomputerwala.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "629M", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1176", "maxsql" : "2", "theme" : "jupiter", "maxpop" : "10", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "user" : "itcomputerwala", "plan" : "websbook_linux_2000mb", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 22023, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "10", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "10", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "has_backup" : 0, "disklimit" : "2000M", "startdate" : "25 Apr 25 19:02", "child_nodes" : [], "unix_startdate" : 1745587950 }, { "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "has_backup" : 0, "disklimit" : "200M", "unix_startdate" : 1362125759, "child_nodes" : [], "startdate" : "13 Mar 01 13:45", "suspendtime" : 0, "owner" : "websbook", "inodesused" : 2126, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "uid" : "1261", "maxsql" : "1", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "websbook_Linux_100mb", "user" : "rnsdcsah", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "rnsinghpgcollege.org.in", "ip" : "51.91.152.238", "diskused" : "69M", "suspendreason" : "not suspended" }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "startdate" : "19 Nov 06 23:30", "child_nodes" : [], "unix_startdate" : 1573063251, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 285, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1313", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "user" : "ssbfoundationorg", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "ssbfoundation.org.in", "suspendreason" : "not suspended", "diskused" : "7M" }, { "maxsub" : "3", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "1", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "disklimit" : "1000M", "has_backup" : 0, "startdate" : "21 May 13 14:48", "child_nodes" : [], "unix_startdate" : 1620897489, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 3487, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "2", "uid" : "1235", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [], "user" : "pharmakit", "plan" : "websbook_1000 MB Linux", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "pharmakit.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "197M" }, { "max_email_per_hour" : "25", "inodesused" : 27262, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 1771310835, "owner" : "otiyahos", "child_nodes" : [], "startdate" : "24 Apr 17 23:03", "unix_startdate" : 1713375219, "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "100000M", "maxlst" : "unlimited", "email" : "togolais2008@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home", "ip" : "51.91.152.238", "domain" : "iyemedia.info", "suspendreason" : "Renouvellement non effectué ", "diskused" : "3292M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "10", "maxparked" : "0", "user" : "iyemedia", "plan" : "otiyahos_ECO", "outgoing_mail_suspended" : 1, "backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "uid" : "1058", "maxsql" : "20", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "unlimited" }, { "inodesused" : 43271, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1755087422, "startdate" : "25 Aug 13 17:47", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "domain" : "sourceoflightodisha.org", "ip" : "51.254.16.113", "diskused" : "954M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "plan" : "winggolearning_raj", "user" : "sourceoflightodi", "outgoing_mail_suspended" : 0, "backup" : 1, "maxsql" : "unlimited", "uid" : "2461", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [] }, { "child_nodes" : [], "startdate" : "25 Jul 18 16:25", "unix_startdate" : 1752836122, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "20", "disklimit" : "1000M", "has_backup" : 0, "maxlst" : "25", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "max_email_per_hour" : "25", "inodesused" : 26056, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "topweblogic", "user" : "myownsite", "plan" : "topweblogic_Silver Package_myownsite", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "2", "uid" : "2132", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "10", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "myownsite.in", "suspendreason" : "not suspended", "diskused" : "554M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0" }, { "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "email" : "*unknown*", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "23 Dec 30 11:09", "unix_startdate" : 1703914770, "owner" : "root", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "500", "inodesused" : 18576, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "100", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "50", "uid" : "1542", "maxsql" : "10", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "mangalamproperti", "plan" : "Economy", "maxaddons" : "0", "maxparked" : "unlimited", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "599M", "ip" : "51.91.152.238", "domain" : "mangalampropertiespune.com" }, { "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "5000M", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "unlimited", "unix_startdate" : 1691372768, "child_nodes" : [], "startdate" : "23 Aug 07 07:16", "suspendtime" : 0, "owner" : "livechen", "max_email_per_hour" : "25", "inodesused" : 4900, "mailbox_format" : "maildir", "shell" : "/bin/bash", "theme" : "jupiter", "uid" : "1153", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "livechen_5GB", "user" : "gainchennaiwebst", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "unlimited", "maxparked" : "unlimited", "ip" : "51.91.152.238", "domain" : "gan.chennaiwebstores.com", "diskused" : "158M", "suspendreason" : "not suspended" }, { "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 42247, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "26 Feb 06 10:52", "unix_startdate" : 1770355357, "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "992M", "ip" : "51.254.16.113", "domain" : "vainifoundation.org", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2767", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "vainifoundation", "plan" : "winggolearning_raj" }, { "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2489", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "utga", "plan" : "winggolearning_raj", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "891M", "domain" : "utga.co.in", "ip" : "51.254.16.113", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Dec 14 20:38", "unix_startdate" : 1734188929, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 35776, "max_email_per_hour" : "25" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "hhtechsolution_H_Basic", "user" : "rowarpurifiers", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "uid" : "2647", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "diskused" : "197M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "rowaterpurifierservicecenter.in", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1730825098, "child_nodes" : [], "startdate" : "24 Nov 05 22:14", "has_backup" : 0, "disklimit" : "250M", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 699, "owner" : "hhtechsolution", "suspendtime" : 0 }, { "plan" : "Red13Backup", "user" : "adbhacom", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1004", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "10", "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "adbha.com", "diskused" : "13598M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "unlimited", "maxaddons" : "4", "unix_startdate" : 1591787410, "child_nodes" : [], "startdate" : "20 Jun 10 16:40", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "lalwanisuniform@gmail.com", "maxlst" : "unlimited", "max_email_per_hour" : "100", "inodesused" : 239227, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "root" }, { "domain" : "rockyardclub.com", "ip" : "51.91.152.238", "diskused" : "7M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "plan" : "websbook_linux_500mb", "user" : "rockyardclub", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "1265", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "inodesused" : 387, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1538496456, "startdate" : "18 Oct 02 21:37", "child_nodes" : [], "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0 }, { "max_email_per_hour" : "25", "inodesused" : 155626, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1704350037, "child_nodes" : [], "startdate" : "24 Jan 04 12:03", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "ip" : "51.254.16.113", "domain" : "winggosoft.com", "diskused" : "4945M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "plan" : "winggolearning_raj", "user" : "winggosoft", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "2509", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 27053, "owner" : "websbook", "suspendtime" : 0, "startdate" : "22 Sep 06 10:46", "child_nodes" : [], "unix_startdate" : 1662441376, "disklimit" : "2000M", "has_backup" : 0, "maxlst" : "10", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "10", "suspendreason" : "not suspended", "diskused" : "1446M", "ip" : "51.91.152.238", "domain" : "sntcollege.in", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "sntcollege", "plan" : "websbook_linux_2000mb", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "10", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1306", "maxsql" : "2" }, { "outgoing_mail_suspended" : 1, "backup" : 1, "user" : "birladha", "plan" : "RED91SSD", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1979", "maxsql" : "unlimited", "suspendreason" : "Overdue on Payment", "diskused" : "83M", "ip" : "51.91.152.238", "domain" : "birladharmshala-ayodhya.online", "maxparked" : "unlimited", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "startdate" : "25 Aug 01 10:09", "child_nodes" : [], "unix_startdate" : 1754023140, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "adslivenow1@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 3794, "owner" : "root", "suspendtime" : 1756621815 }, { "max_email_per_hour" : "25", "inodesused" : 1804, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1573106260, "child_nodes" : [], "startdate" : "19 Nov 07 11:27", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0", "ip" : "51.91.152.238", "domain" : "mvpvtiti.org.in", "diskused" : "156M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "plan" : "websbook_linux_500mb", "user" : "mvpvtiti", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1221", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1 }, { "inodesused" : 303, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "25 May 26 17:27", "child_nodes" : [], "unix_startdate" : 1748260637, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "domain" : "apnigaushala.org", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "7M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "user" : "apnigaushala", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2182", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [] }, { "inodesused" : 146, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/false", "suspendtime" : 1777911121, "owner" : "otiyahos", "unix_startdate" : 1625346276, "child_nodes" : [], "startdate" : "21 Jul 04 02:34", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 1, "email" : "togolais2008@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "unlimited", "disklimit" : "100000M", "has_backup" : 0, "domain" : "otiya.com", "ip" : "51.91.152.238", "diskused" : "3M", "suspendreason" : "Renouvellement non effectué ", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "10", "maxparked" : "0", "plan" : "otiyahos_ECO", "user" : "otiya", "backup" : 1, "outgoing_mail_suspended" : 1, "uid" : "1033", "maxsql" : "20", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [] }, { "startdate" : "24 Dec 17 17:14", "child_nodes" : [], "unix_startdate" : 1734435898, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 36152, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "user" : "sbsraac", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2432", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "sbsraac.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "892M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 24097, "owner" : "skystechnology", "suspendtime" : 0, "unix_startdate" : 1745949037, "child_nodes" : [], "startdate" : "25 Apr 29 23:20", "disklimit" : "unlimited", "has_backup" : 0, "email" : "pannasnacksandgrocery@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "diskused" : "906M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "pannasnacksandgrocery.com", "maxaddons" : "5", "maxparked" : "5", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "skystechnology_skystech_premium_ornests", "user" : "pannasnacksandgr", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1424", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited" }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "camiorg.com", "diskused" : "932M", "suspendreason" : "not suspended", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2571", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "plan" : "winggolearning_raj", "user" : "camiorg", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 46007, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "unix_startdate" : 1763790892, "startdate" : "25 Nov 22 11:24", "child_nodes" : [] }, { "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "35M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "mahilasevasadan.org", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "uid" : "1206", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500mb", "user" : "mahilasevasadan", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 1121, "disklimit" : "500M", "has_backup" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "unix_startdate" : 1502554740, "child_nodes" : [], "startdate" : "17 Aug 12 21:49" }, { "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 43094, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1759587413, "child_nodes" : [], "startdate" : "25 Oct 04 19:46", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "stepagainsthungerfoundation.org", "ip" : "51.254.16.113", "diskused" : "922M", "suspendreason" : "not suspended", "uid" : "2521", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "plan" : "winggolearning_raj", "user" : "stepagainsthunge", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2522", "maxsql" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "theunnati", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "986M", "ip" : "51.254.16.113", "domain" : "theunnati.in", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "25 Oct 07 11:18", "child_nodes" : [], "unix_startdate" : 1759816088, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 43354 }, { "diskused" : "446M", "suspendreason" : "not suspended", "domain" : "nfcdindia.com", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_2000mb", "user" : "nfcdindia", "maxpop" : "10", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxsql" : "2", "uid" : "1223", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 3581, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0, "unix_startdate" : 1578908167, "child_nodes" : [], "startdate" : "20 Jan 13 15:06", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "10", "disklimit" : "2000M", "has_backup" : 0, "maxsub" : "10", "inodeslimit" : "unlimited", "suspended" : 0 }, { "max_email_per_hour" : "25", "inodesused" : 1925, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "startdate" : "19 Nov 07 12:13", "child_nodes" : [], "unix_startdate" : 1573109007, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "ip" : "51.91.152.238", "domain" : "vdpvtiti.org.in", "suspendreason" : "not suspended", "diskused" : "127M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "vdpvtiti", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1331", "maxsql" : "1", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1 }, { "unix_startdate" : 1416766529, "child_nodes" : [], "startdate" : "14 Nov 23 23:45", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "0", "max_email_per_hour" : "25", "inodesused" : 1020, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "plan" : "websbook_linux_500mb", "user" : "primedealco", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1242", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "primedeal.co.in", "diskused" : "41M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0" }, { "startdate" : "25 Sep 15 18:41", "child_nodes" : [], "unix_startdate" : 1757941884, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 42541, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "divyasetu", "plan" : "winggolearning_raj", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2241", "maxsql" : "unlimited", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "893M", "domain" : "divyasetu.org", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0 }, { "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1456", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "user" : "prabhatdiagnosti", "plan" : "crazyhos_New", "outgoing_mail_suspended" : 1, "backup" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "unlimited", "domain" : "prabhatdiagnostic.com", "ip" : "51.91.152.238", "suspendreason" : "Overdue on Payment", "diskused" : "33076M", "maxsub" : "unlimited", "suspended" : 1, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "prabhat563@gmail.com", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited", "child_nodes" : [], "startdate" : "22 Jun 16 13:41", "unix_startdate" : 1655367078, "suspendtime" : 1765953021, "owner" : "dnsscom", "inodesused" : 123921, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "736M", "suspendreason" : "not suspended", "domain" : "woodzyaroma.com", "ip" : "51.91.152.238", "maxpop" : "10", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxsql" : "2", "uid" : "2148", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "topweblogic_Silver Package", "user" : "woodzyaroma", "owner" : "topweblogic", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 20204, "max_email_per_hour" : "25", "partition" : "home2", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "25", "has_backup" : 0, "disklimit" : "1000M", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1687934027, "child_nodes" : [], "startdate" : "23 Jun 28 12:03" }, { "has_backup" : 0, "disklimit" : "1500M", "maxlst" : "1", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "startdate" : "25 Jun 16 20:26", "child_nodes" : [], "unix_startdate" : 1750085765, "owner" : "hhtechsolution", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 3556, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "10", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "2634", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "mahmalshrqi", "plan" : "hhtechsolution_H_Adv", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1025M", "ip" : "51.91.152.238", "domain" : "mahmalshrqi.com" }, { "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2319", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "maabhartivaahine", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "maabhartivaahinee.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "896M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Sep 07 11:00", "unix_startdate" : 1725687003, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 36533, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "unix_startdate" : 1525836865, "startdate" : "18 May 09 09:04", "child_nodes" : [], "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0, "inodesused" : 701, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "plan" : "websbook_linux_500mb", "user" : "bereniketechnolo", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "1", "uid" : "1108", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "domain" : "bereniketechnology.com", "ip" : "51.91.152.238", "diskused" : "30M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0" }, { "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "jansevaa.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "842M", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2827", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "user" : "sjans", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 66756, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "startdate" : "26 Mar 30 16:06", "child_nodes" : [], "unix_startdate" : 1774866983 }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "lifechangediagnostic.co.in", "ip" : "51.91.152.238", "diskused" : "421M", "suspendreason" : "not suspended", "uid" : "1479", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "plan" : "royaldiagnosticc_Unlimited", "user" : "lifechangediagno", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "royaldiagnosticc", "inodesused" : 41175, "max_email_per_hour" : "30", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1691208436, "child_nodes" : [], "startdate" : "23 Aug 05 09:37" }, { "user" : "rlbpvtiti", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1257", "maxsql" : "1", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "ip" : "51.91.152.238", "domain" : "rlbpvtiti.com", "suspendreason" : "not suspended", "diskused" : "21M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "startdate" : "16 May 08 20:16", "child_nodes" : [], "unix_startdate" : 1462718793, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "max_email_per_hour" : "25", "inodesused" : 893, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook" }, { "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 37400, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "startdate" : "24 Nov 27 16:13", "child_nodes" : [], "unix_startdate" : 1732704182, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "risingyouthsocialfoundation.co.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "975M", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2395", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "user" : "risingyouth", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2210", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "user" : "bremt", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "bremt.org", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "2491M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "child_nodes" : [], "startdate" : "25 Apr 08 11:15", "unix_startdate" : 1744091121, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 157689, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "26 Mar 09 13:17", "unix_startdate" : 1773042470, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 68489, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2804", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "saharatrust2012", "plan" : "winggolearning_raj", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "907M", "ip" : "51.254.16.113", "domain" : "saharatrust2012.in" }, { "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "maxsql" : "20", "uid" : "1046", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "wwwgakogoe", "plan" : "otiyahos_ECO", "maxparked" : "0", "maxaddons" : "10", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "21954M", "domain" : "gakogoe.com", "ip" : "51.91.152.238", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "togolais2008@gmail.com", "disklimit" : "100000M", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "21 Jan 23 23:35", "child_nodes" : [], "unix_startdate" : 1611425154, "owner" : "otiyahos", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 134981, "max_email_per_hour" : "25" }, { "ip" : "51.254.16.113", "domain" : "surabhiwelfareeducationtrust.co.in", "suspendreason" : "not suspended", "diskused" : "888M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "user" : "surabhiwelfare", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2471", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "max_email_per_hour" : "25", "inodesused" : 43359, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "child_nodes" : [], "startdate" : "24 Dec 23 12:05", "unix_startdate" : 1734935725, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0 }, { "inodesused" : 24943, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "thesunda", "startdate" : "25 Jul 17 12:14", "child_nodes" : [], "unix_startdate" : 1752734662, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "sacretcode@gmail.com", "disklimit" : "1024M", "has_backup" : 0, "domain" : "balajitails.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "605M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "balajitails", "plan" : "thesunda_cine1024_balajitails", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "5", "uid" : "1974", "theme" : "jupiter", "maxpop" : "3", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "unlimited" }, { "domain" : "ngogovindamfoundation.org", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "967M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "user" : "ngogovindamfound", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2770", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "inodesused" : 45413, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "child_nodes" : [], "startdate" : "26 Feb 07 14:00", "unix_startdate" : 1770453018, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited" }, { "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "1140", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "user" : "dpandeypharmacy", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "dpandeypharmacy.co.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "66M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "has_backup" : 0, "disklimit" : "500M", "startdate" : "22 Sep 27 15:31", "child_nodes" : [], "unix_startdate" : 1664272915, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 2328, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "33M", "suspendreason" : "not suspended", "domain" : "crmjournal.in", "ip" : "51.91.152.238", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "uid" : "1130", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "crmjournal", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 965, "max_email_per_hour" : "25", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1601283721, "startdate" : "20 Sep 28 14:32", "child_nodes" : [] }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 46132, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "child_nodes" : [], "startdate" : "25 Aug 05 17:04", "unix_startdate" : 1754393671, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "1000M", "domain" : "sahakarmanchfoundation.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "sahakarmanchfoun", "plan" : "winggolearning_raj", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2405", "theme" : "jupiter" }, { "max_email_per_hour" : "unlimited", "inodesused" : 1730, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1362559045, "child_nodes" : [], "startdate" : "13 Mar 06 14:07", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "has_backup" : 0, "disklimit" : "200M", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "0", "ip" : "51.91.152.238", "domain" : "gssmahavidyalaya.org.in", "diskused" : "45M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "plan" : "websbook_Linux_100mb", "user" : "gssmahav", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1162", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "5" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 45335, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "child_nodes" : [], "startdate" : "25 Jul 10 13:57", "unix_startdate" : 1752136050, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "925M", "domain" : "adssngo.org", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "adssngo", "plan" : "winggolearning_raj", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2168", "theme" : "jupiter" }, { "domain" : "equipmentsme.com", "ip" : "51.91.152.238", "diskused" : "36128M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "plan" : "Red11Backup", "user" : "equipmen", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "1009", "maxsql" : "20", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "10", "ipv6" : [], "inodesused" : 300834, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "root", "unix_startdate" : 1670433106, "child_nodes" : [], "startdate" : "22 Dec 07 22:41", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home", "outgoing_mail_hold" : 0, "email" : "equipmentsme@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "jantamoneypower", "plan" : "websbook_linux_500mb", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1177", "maxsql" : "1", "suspendreason" : "not suspended", "diskused" : "35M", "ip" : "51.91.152.238", "domain" : "jantamoneypower.com", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "startdate" : "17 Oct 30 17:54", "child_nodes" : [], "unix_startdate" : 1509366291, "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 892, "owner" : "websbook", "suspendtime" : 0 }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "has_backup" : 0, "disklimit" : "1500M", "maxlst" : "1", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "child_nodes" : [], "startdate" : "26 Mar 14 10:25", "unix_startdate" : 1773464125, "suspendtime" : 0, "owner" : "hhtechsolution", "max_email_per_hour" : "25", "inodesused" : 966, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2810", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "10", "user" : "lokseeds", "plan" : "hhtechsolution_H_Adv", "outgoing_mail_suspended" : 0, "backup" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "lokseeds.com", "suspendreason" : "not suspended", "diskused" : "154M" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 120937, "max_email_per_hour" : "unlimited", "owner" : "root", "suspendtime" : 0, "unix_startdate" : 1724748828, "startdate" : "24 Aug 27 14:23", "child_nodes" : [], "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "maxlst" : "unlimited", "disklimit" : "50000M", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "1804M", "suspendreason" : "not suspended", "domain" : "apk.quest", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "RED901RESELLER", "user" : "apkquest", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "uid" : "1348", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter" }, { "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1746277396, "child_nodes" : [], "startdate" : "25 May 03 18:33", "suspendtime" : 0, "owner" : "niipmcom", "inodesused" : 9125, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsql" : "unlimited", "uid" : "1074", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "default", "user" : "parcharwala", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "parcharwala.in", "ip" : "51.91.152.238", "diskused" : "210M", "suspendreason" : "not suspended" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "hariplgovindagro", "plan" : "websbook_Unlimited Linux", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "30", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1164", "maxsql" : "15", "suspendreason" : "not suspended", "diskused" : "1487M", "ip" : "51.91.152.238", "domain" : "hargovindagroipl.online", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "child_nodes" : [], "startdate" : "22 Dec 15 21:14", "unix_startdate" : 1671119041, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 29019, "owner" : "websbook", "suspendtime" : 0 }, { "suspendtime" : 0, "owner" : "otiyahos", "max_email_per_hour" : "unlimited", "inodesused" : 208726, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "togolais2008@gmail.com", "partition" : "home", "startdate" : "22 Dec 01 14:55", "child_nodes" : [], "unix_startdate" : 1669886750, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "unlimited", "maxaddons" : "10", "ip" : "51.91.152.238", "domain" : "djena.tg", "suspendreason" : "not suspended", "diskused" : "31242M", "theme" : "jupiter", "maxftp" : "20", "max_emailacct_quota" : "unlimited", "uid" : "1057", "maxsql" : "20", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "20", "user" : "djena", "plan" : "otiyahos_ECO_afriksportnews", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "max_email_per_hour" : "25", "inodesused" : 70915, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "26 Feb 24 11:28", "child_nodes" : [], "unix_startdate" : 1771912693, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "ip" : "51.254.16.113", "domain" : "maxxcaretrust.com", "suspendreason" : "not suspended", "diskused" : "903M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "user" : "maxxcaretrust", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2790", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0 }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 45467, "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "25 Jul 14 11:44", "child_nodes" : [], "unix_startdate" : 1752473645, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "suspendreason" : "not suspended", "diskused" : "929M", "ip" : "51.254.16.113", "domain" : "equalrootsfoundation.org", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "equalroots", "plan" : "winggolearning_raj", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2247" }, { "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1090", "maxsql" : "1", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "aipsprayagraj", "plan" : "websbook_linux_500mb", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "97M", "ip" : "51.91.152.238", "domain" : "aipsprayagraj.org", "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "child_nodes" : [], "startdate" : "19 Mar 29 04:30", "unix_startdate" : 1553814015, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 2825 }, { "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 28749, "max_email_per_hour" : "25", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "10000M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "23 Dec 04 17:02", "child_nodes" : [], "unix_startdate" : 1701689553, "maxaddons" : "5", "maxparked" : "unlimited", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1213M", "domain" : "fidelaindia.com", "ip" : "51.254.16.113", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2250", "maxsql" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "fidelaindia", "plan" : "root_raj" }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "rootx13.cpanel.ciaindia.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "2M", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2878", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "user" : "rootx13", "plan" : "default", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "root", "inodesused" : 126, "max_email_per_hour" : "*unknown*", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "*unknown*", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "startdate" : "26 May 02 05:56", "child_nodes" : [], "unix_startdate" : 1777681595 }, { "child_nodes" : [], "startdate" : "24 Dec 17 14:23", "unix_startdate" : 1734425599, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 42877, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "user" : "ayurvedjanjagran", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2196", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "ayurvedjanjagranmission.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1468M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1" }, { "plan" : "ashutosh_dev", "user" : "cpslucknow", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "2221", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.254.16.113", "domain" : "cpslucknow.com", "diskused" : "951M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "5", "maxparked" : "0", "unix_startdate" : 1656652842, "startdate" : "22 Jul 01 10:50", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "10000M", "has_backup" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "rvsingh7843@gmail.com", "maxlst" : "unlimited", "max_email_per_hour" : "unlimited", "inodesused" : 20864, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning" }, { "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2390", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "ramanujatrust", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "966M", "domain" : "ramanujatrust.in", "ip" : "51.254.16.113", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "25 Jun 27 14:01", "child_nodes" : [], "unix_startdate" : 1751013076, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 46517, "max_email_per_hour" : "25" }, { "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "10M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "rajdegreecollege.in", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxsql" : "1", "uid" : "1247", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "rajdegreecollege", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 391, "has_backup" : 0, "disklimit" : "500M", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "unix_startdate" : 1577777653, "startdate" : "19 Dec 31 13:04", "child_nodes" : [] }, { "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited", "disklimit" : "250M", "has_backup" : 0, "unix_startdate" : 1670585489, "startdate" : "22 Dec 09 17:01", "child_nodes" : [], "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 10496, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsql" : "1", "uid" : "2674", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "30", "ipv6" : [], "plan" : "hhtechsolution_H_Basic", "user" : "tsmtechno", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "domain" : "tsmtechno.com", "ip" : "51.91.152.238", "diskused" : "180M", "suspendreason" : "not suspended" }, { "suspendreason" : "not suspended", "diskused" : "11M", "ip" : "51.91.152.238", "domain" : "rnsiti.com", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "rnsiti", "plan" : "websbook_Linux_100mb", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "uid" : "1262", "maxsql" : "1", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 666, "owner" : "websbook", "suspendtime" : 0, "startdate" : "14 May 10 10:06", "child_nodes" : [], "unix_startdate" : 1399696582, "disklimit" : "200M", "has_backup" : 0, "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5" }, { "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Nov 12 17:52", "unix_startdate" : 1731414147, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 70880, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2218", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "user" : "clubsanatan", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "clubsanatan.com", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1291M" }, { "diskused" : "876M", "suspendreason" : "not suspended", "domain" : "mkdet.co.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "mkdet", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2339", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 32933, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1721631568, "child_nodes" : [], "startdate" : "24 Jul 22 12:29", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "max_email_per_hour" : "unlimited", "inodesused" : 10349, "shell" : "/bin/false", "mailbox_format" : "maildir", "suspendtime" : 1778221815, "owner" : "pawsnmei", "child_nodes" : [], "startdate" : "24 Oct 14 15:06", "unix_startdate" : 1728898613, "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "onedestinyahead@gmail.com", "partition" : "home2", "ip" : "51.91.152.238", "domain" : "edgewise.co.in", "suspendreason" : "Overdue on Payment", "diskused" : "500M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "edgewiseco", "plan" : "default", "outgoing_mail_suspended" : 1, "backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1520", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1 }, { "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1773228038, "startdate" : "26 Mar 11 16:50", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 66983, "max_email_per_hour" : "25", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2807", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "prernapunjfounda", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "811M", "suspendreason" : "not suspended", "domain" : "prernapunjfoundation.in", "ip" : "51.254.16.113" }, { "owner" : "topweblogic", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 3639, "max_email_per_hour" : "25", "partition" : "home2", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "25", "has_backup" : 0, "disklimit" : "1000M", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1631694230, "startdate" : "21 Sep 15 13:53", "child_nodes" : [], "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "65M", "suspendreason" : "not suspended", "domain" : "friend2friend.co.in", "ip" : "51.91.152.238", "maxpop" : "10", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxsql" : "2", "uid" : "2122", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "topweblogic_Silver Package", "user" : "friend2friend" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "igcf", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2283", "maxsql" : "unlimited", "suspendreason" : "not suspended", "diskused" : "986M", "ip" : "51.254.16.113", "domain" : "igcf.ngo", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "startdate" : "25 Aug 11 18:50", "child_nodes" : [], "unix_startdate" : 1754918403, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 46940, "owner" : "winggolearning", "suspendtime" : 0 }, { "suspendreason" : "not suspended", "diskused" : "171M", "ip" : "51.91.152.238", "domain" : "local24x7news.in", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "local24x7", "plan" : "default", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1071", "maxsql" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 15722, "owner" : "niipmcom", "suspendtime" : 0, "child_nodes" : [], "startdate" : "24 Nov 27 10:28", "unix_startdate" : 1732683508, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "info@local24x7news.in", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited" }, { "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 44943, "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1761556828, "child_nodes" : [], "startdate" : "25 Oct 27 14:50", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1054M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "teammahantyogisupportersanghtrust.in", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2546", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "teammahantyogisu" }, { "user" : "cgkaushalvikas", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2214", "maxsql" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.254.16.113", "domain" : "cgkaushalvikas.com", "suspendreason" : "not suspended", "diskused" : "982M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "child_nodes" : [], "startdate" : "24 Dec 04 18:34", "unix_startdate" : 1733317468, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "max_email_per_hour" : "25", "inodesused" : 40324, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "child_nodes" : [], "startdate" : "25 Oct 03 22:48", "unix_startdate" : 1759511907, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "togolais2008@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "100000M", "inodesused" : 33678, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "otiyahos", "user" : "salonagriculture", "plan" : "otiyahos_ECO", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "10", "max_emailacct_quota" : "unlimited", "maxsql" : "20", "uid" : "2520", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "domain" : "salon-agriculture.tg", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "11618M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "10", "maxparked" : "0" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "rnpdegreecollege", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxsql" : "1", "uid" : "1260", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "237M", "suspendreason" : "not suspended", "domain" : "rnpdegreecollege.org", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1438146386, "startdate" : "15 Jul 29 10:36", "child_nodes" : [], "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 4139, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0 }, { "maxlst" : "unlimited", "partition" : "home2", "email" : "*unknown*", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Dec 01 10:27", "unix_startdate" : 1733029078, "owner" : "royaldiagnosticc", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 21854, "max_email_per_hour" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1472", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "hussainkadam", "plan" : "default", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "426M", "domain" : "hussainkadam.in", "ip" : "51.91.152.238" }, { "unix_startdate" : 1727264068, "startdate" : "24 Sep 25 17:04", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 33660, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "plan" : "winggolearning_raj", "user" : "sanaawelfare", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "2412", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "sanaawelfarefoundation.in", "ip" : "51.254.16.113", "diskused" : "961M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1" }, { "diskused" : "1333M", "suspendreason" : "not suspended", "domain" : "kidsacademyprayagraj.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "undefined", "user" : "kidsacademypraya", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxsql" : "unlimited", "uid" : "1362", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 2467, "max_email_per_hour" : "25", "owner" : "apkquest", "suspendtime" : 0, "unix_startdate" : 1727825270, "child_nodes" : [], "startdate" : "24 Oct 02 04:57", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "maxlst" : "unlimited", "disklimit" : "2536M", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "user" : "bharatkalyanseva", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2535", "maxsql" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "ip" : "51.254.16.113", "domain" : "bharatkalyansevafoundation.org", "suspendreason" : "not suspended", "diskused" : "995M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "child_nodes" : [], "startdate" : "25 Oct 17 19:54", "unix_startdate" : 1760711096, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "max_email_per_hour" : "25", "inodesused" : 58512, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "unix_startdate" : 1767874328, "child_nodes" : [], "startdate" : "26 Jan 08 17:42", "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 65582, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "uid" : "2738", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "plan" : "winggolearning_raj", "user" : "dbst", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "domain" : "dbst.co.in", "ip" : "51.254.16.113", "diskused" : "1262M", "suspendreason" : "not suspended" }, { "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "7816M", "domain" : "thecreativelauncher.com", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "30", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "15", "uid" : "1346", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "thecreativelaunc", "plan" : "websbook_Unlimited Linux", "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 108684, "max_email_per_hour" : "25", "maxlst" : "0", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "16 Mar 03 15:45", "child_nodes" : [], "unix_startdate" : 1457000156 }, { "suspendreason" : "not suspended", "diskused" : "254M", "ip" : "51.91.152.238", "domain" : "ltslebanon.com", "maxaddons" : "5", "maxparked" : "5", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "ltslebanon", "plan" : "skystechnology_skystech_premium_ornests", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1967", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 9513, "owner" : "skystechnology", "suspendtime" : 0, "child_nodes" : [], "startdate" : "25 Jun 27 21:01", "unix_startdate" : 1751038314, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "skystechnologyllp@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited" }, { "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1756458681, "child_nodes" : [], "startdate" : "25 Aug 29 14:41", "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 42348, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "uid" : "2362", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "plan" : "winggolearning_raj", "user" : "nrisocial", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "nrisocial.in", "ip" : "51.254.16.113", "diskused" : "883M", "suspendreason" : "not suspended" }, { "startdate" : "25 May 28 17:17", "child_nodes" : [], "unix_startdate" : 1748432821, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 388, "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "ramacivilgroups", "plan" : "winggolearning_raj", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2389", "maxsql" : "unlimited", "suspendreason" : "not suspended", "diskused" : "7M", "ip" : "51.254.16.113", "domain" : "ramacivilgroups.com", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0 }, { "unix_startdate" : 1763451615, "startdate" : "25 Nov 18 13:10", "child_nodes" : [], "has_backup" : 0, "disklimit" : "250M", "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 765, "owner" : "hhtechsolution", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "hhtechsolution_H_Basic", "user" : "primecoreinfotec", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2640", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "diskused" : "72M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "primecoreinfotech.com", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "unix_startdate" : 1776073608, "startdate" : "26 Apr 13 15:16", "child_nodes" : [], "has_backup" : 0, "disklimit" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 67678, "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "yodhafoundation", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2853", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "diskused" : "1021M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "yodhafoundation.in", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1376", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "user" : "sjsshankargarh", "plan" : "apkquest_512mb", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "sjsshankargarh.org", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "277M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "512M", "has_backup" : 0, "child_nodes" : [], "startdate" : "24 Oct 03 09:46", "unix_startdate" : 1727928961, "suspendtime" : 0, "owner" : "apkquest", "inodesused" : 1690, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "startdate" : "25 Apr 10 13:43", "child_nodes" : [], "unix_startdate" : 1744272785, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 2088, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1342", "maxsql" : "1", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "yaspublicschool", "plan" : "websbook_linux_500mb", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "83M", "ip" : "51.91.152.238", "domain" : "yaspublicschool.com" }, { "suspendtime" : 0, "owner" : "topweblogic", "max_email_per_hour" : "100", "inodesused" : 52276, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "topweblogic@gmail.com", "child_nodes" : [], "startdate" : "18 Feb 16 18:55", "unix_startdate" : 1518787533, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "unlimited", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "topweblogic.com", "suspendreason" : "not suspended", "diskused" : "1985M", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2041", "maxsql" : "unlimited", "max_defer_fail_percentage" : "100", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "user" : "topweblogic", "plan" : "RED34RESELLER", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 18274, "max_email_per_hour" : "30", "owner" : "royaldiagnosticc", "suspendtime" : 0, "unix_startdate" : 1697430256, "child_nodes" : [], "startdate" : "23 Oct 16 09:54", "email" : "*unknown*", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "170M", "suspendreason" : "not suspended", "domain" : "uniquehealth.in", "ip" : "51.91.152.238", "maxparked" : "1", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "royaldiagnosticc_Unlimited plan", "user" : "uniquehealth", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "maxsql" : "unlimited", "uid" : "1500", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter" }, { "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2177", "maxsql" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "alkhairmission", "plan" : "winggolearning_raj", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "860M", "domain" : "alkhairmissionfoundation.in", "ip" : "51.254.16.113", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "24 Nov 12 17:27", "child_nodes" : [], "unix_startdate" : 1731412630, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 35666, "max_email_per_hour" : "25" }, { "ip" : "51.254.16.113", "domain" : "deepgunj.org", "suspendreason" : "not suspended", "diskused" : "955M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "user" : "deepgunj", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2229", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "max_email_per_hour" : "25", "inodesused" : 46424, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "25 Apr 05 17:59", "child_nodes" : [], "unix_startdate" : 1743856178, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0 }, { "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "38M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "bholahospitalandinstitute.org", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1111", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_Linux_100mb", "user" : "bholahospitaland", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 491, "has_backup" : 0, "disklimit" : "200M", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "unix_startdate" : 1455513757, "startdate" : "16 Feb 15 10:52", "child_nodes" : [] }, { "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "250M", "unix_startdate" : 1612433527, "startdate" : "21 Feb 04 15:42", "child_nodes" : [], "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 955, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsql" : "1", "uid" : "2673", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "30", "ipv6" : [], "plan" : "hhtechsolution_H_Basic", "user" : "travelgenixco", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "travelgenix.co.in", "ip" : "51.91.152.238", "diskused" : "55M", "suspendreason" : "not suspended" }, { "startdate" : "24 Jul 27 11:02", "child_nodes" : [], "unix_startdate" : 1722058349, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "max_email_per_hour" : "25", "inodesused" : 31694, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "user" : "lokkalyanseva", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2317", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.254.16.113", "domain" : "lokkalyansevatrust.org", "suspendreason" : "not suspended", "diskused" : "903M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1" }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "10", "maxparked" : "10", "ip" : "51.91.152.238", "domain" : "antarcounseling.com", "diskused" : "1443M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "1094", "maxsql" : "10", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "10", "legacy_backup" : 1, "plan" : "websiteg_Pack1", "user" : "antarcounseling", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "websiteg", "max_email_per_hour" : "unlimited", "inodesused" : 27435, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "10", "disklimit" : "10000M", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "10", "unix_startdate" : 1548168151, "child_nodes" : [], "startdate" : "19 Jan 22 20:12" }, { "domain" : "balramsanskritmahavidyalaya.org.in", "ip" : "51.91.152.238", "diskused" : "53M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "plan" : "websbook_Linux_100mb", "user" : "balramsa", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "1106", "maxsql" : "1", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "inodesused" : 1311, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1361010285, "startdate" : "13 Feb 16 15:54", "child_nodes" : [], "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "disklimit" : "200M", "has_backup" : 0 }, { "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 45889, "has_backup" : 0, "disklimit" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1757083053, "startdate" : "25 Sep 05 20:07", "child_nodes" : [], "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "988M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "sjbwe.in", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2458", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "sjbwe" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 80529, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1771406463, "child_nodes" : [], "startdate" : "26 Feb 18 14:51", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "diskused" : "1366M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "madhuramuf.com", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "huramuf", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2784", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited" }, { "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "uid" : "1134", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_Linux_100mb", "user" : "deenanathvidhima", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "25M", "suspendreason" : "not suspended", "domain" : "deenanathvidhimahavidyalaya.org", "ip" : "51.91.152.238", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "has_backup" : 0, "disklimit" : "200M", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1468389376, "child_nodes" : [], "startdate" : "16 Jul 13 11:26", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1545, "max_email_per_hour" : "unlimited" }, { "theme" : "jupiter", "uid" : "1544", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "otiyahos_Pack-Webmaster", "user" : "togofoot", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "unlimited", "maxparked" : "unlimited", "ip" : "51.91.152.238", "domain" : "togofoot.tg", "diskused" : "25985M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "togolais2008@gmail.com", "maxlst" : "unlimited", "unix_startdate" : 1671168395, "child_nodes" : [], "startdate" : "22 Dec 16 10:56", "suspendtime" : 0, "owner" : "otiyaho2", "max_email_per_hour" : "25", "inodesused" : 417208, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "sacretcode@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "2048M", "unix_startdate" : 1705144610, "startdate" : "24 Jan 13 16:46", "child_nodes" : [], "suspendtime" : 0, "owner" : "thesunda", "inodesused" : 16905, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "uid" : "1405", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "thesunda_Metalart2GB", "user" : "dolphinwaste", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "dolphin-waste.com", "ip" : "51.91.152.238", "diskused" : "509M", "suspendreason" : "not suspended" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_Linux_100mb", "user" : "shivkali", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxsql" : "1", "uid" : "1285", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "theme" : "jupiter", "diskused" : "99M", "suspendreason" : "not suspended", "domain" : "shivkaliyadavjbmahavidyalaya.org", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1407237059, "child_nodes" : [], "startdate" : "14 Aug 05 16:40", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "0", "has_backup" : 0, "disklimit" : "200M", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 999, "max_email_per_hour" : "unlimited", "owner" : "websbook", "suspendtime" : 0 }, { "startdate" : "23 Mar 02 10:50", "child_nodes" : [], "unix_startdate" : 1677734434, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "disklimit" : "250M", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "max_email_per_hour" : "25", "inodesused" : 1139, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "hhtechsolution", "user" : "imagedesigns", "plan" : "hhtechsolution_H_Basic", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "2622", "maxsql" : "1", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "imagedesigns.in", "suspendreason" : "not suspended", "diskused" : "114M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0" }, { "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1201", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "user" : "linesstudio", "plan" : "websiteg_unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "unlimited", "maxaddons" : "unlimited", "ip" : "51.91.152.238", "domain" : "linesstudio.in", "suspendreason" : "not suspended", "diskused" : "2308M", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "startdate" : "19 Jul 06 23:05", "child_nodes" : [], "unix_startdate" : 1562434539, "suspendtime" : 0, "owner" : "websiteg", "max_email_per_hour" : "unlimited", "inodesused" : 17734, "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "startdate" : "25 Jul 09 22:07", "child_nodes" : [], "unix_startdate" : 1752079068, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "has_backup" : 0, "disklimit" : "250M", "maxlst" : "unlimited", "partition" : "home2", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "max_email_per_hour" : "25", "inodesused" : 871, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "hhtechsolution", "user" : "matafurnitures", "plan" : "hhtechsolution_H_Basic", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "2635", "maxsql" : "1", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "ip" : "51.91.152.238", "domain" : "matafurnitures.com", "suspendreason" : "not suspended", "diskused" : "129M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0" }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "child_nodes" : [], "startdate" : "22 Dec 19 16:12", "unix_startdate" : 1671446537, "suspendtime" : 0, "owner" : "topweblogic", "max_email_per_hour" : "*unknown*", "inodesused" : 48495, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2123", "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "legacy_backup" : 1, "maxpop" : "unlimited", "user" : "ganesha", "plan" : "default", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "topweblogic.us", "suspendreason" : "not suspended", "diskused" : "1181M" }, { "user" : "humanvision", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2278", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "humanvisionfoundation.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1066M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "startdate" : "24 Jun 28 12:34", "child_nodes" : [], "unix_startdate" : 1719558261, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 46140, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 47916, "owner" : "websbook", "suspendtime" : 0, "child_nodes" : [], "startdate" : "17 Jul 14 23:55", "unix_startdate" : 1500056720, "disklimit" : "2000M", "has_backup" : 0, "maxlst" : "10", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "10", "suspendreason" : "not suspended", "diskused" : "1432M", "ip" : "51.91.152.238", "domain" : "sntpublicschool.in", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "sntpublicschool", "plan" : "websbook_linux_2000mb", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "10", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1308", "maxsql" : "2" }, { "max_email_per_hour" : "25", "inodesused" : 45791, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1743143949, "child_nodes" : [], "startdate" : "25 Mar 28 12:09", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "ip" : "51.254.16.113", "domain" : "santulanofficial.in", "diskused" : "941M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "plan" : "winggolearning_raj", "user" : "santulanofficial", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "2420", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited" }, { "diskused" : "463M", "suspendreason" : "not suspended", "domain" : "hhtechsolution.co.in", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "RED901RESELLER_hhtechsolution", "user" : "hhtechsolution", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2585", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1721, "max_email_per_hour" : "25", "owner" : "root", "suspendtime" : 0, "unix_startdate" : 1611919304, "startdate" : "21 Jan 29 16:51", "child_nodes" : [], "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "5120M", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "5", "maxparked" : "unlimited", "ip" : "51.254.16.113", "domain" : "revive-nutra.com", "diskused" : "822M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "2394", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "root_raj", "user" : "revivenutra", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 23109, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "10000M", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1693062235, "child_nodes" : [], "startdate" : "23 Aug 26 20:33" }, { "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1513935983, "startdate" : "17 Dec 22 15:16", "child_nodes" : [], "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 845, "max_email_per_hour" : "25", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "uid" : "1253", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "rbsprivateiti", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "27M", "suspendreason" : "not suspended", "domain" : "rbsprivateiti.com", "ip" : "51.91.152.238" }, { "child_nodes" : [], "startdate" : "26 May 05 15:11", "unix_startdate" : 1777974115, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "500M", "inodesused" : 7367, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "user" : "homeotajclinic", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "2888", "maxsql" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "20", "domain" : "homeotajclinic.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "502M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0" }, { "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "2664", "maxsql" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "soniminitranspor", "plan" : "hhtechsolution_H_Basic", "outgoing_mail_suspended" : 0, "backup" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "soniminitransport.co.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "105M", "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "disklimit" : "250M", "has_backup" : 0, "startdate" : "21 Dec 17 15:09", "child_nodes" : [], "unix_startdate" : 1639733994, "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 926, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "indogmafilms.com", "ip" : "51.91.152.238", "diskused" : "1645M", "suspendreason" : "not suspended", "maxsql" : "unlimited", "uid" : "1413", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "plan" : "default", "user" : "indogmafilms", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "thesunda", "inodesused" : 34619, "max_email_per_hour" : "150", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "sacretcode@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "unix_startdate" : 1579786278, "startdate" : "20 Jan 23 19:01", "child_nodes" : [] }, { "diskused" : "24M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "hsdbtc.org.in", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_Linux_100mb", "user" : "hsdbtc", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1168", "maxsql" : "1", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 526, "owner" : "websbook", "suspendtime" : 0, "unix_startdate" : 1509172334, "startdate" : "17 Oct 28 12:02", "child_nodes" : [], "has_backup" : 0, "disklimit" : "200M", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5" }, { "child_nodes" : [], "startdate" : "24 Apr 27 17:34", "unix_startdate" : 1714219460, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 32865, "owner" : "winggolearning", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "samyakfoundation", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2411", "suspendreason" : "not suspended", "diskused" : "939M", "ip" : "51.254.16.113", "domain" : "samyakfoundationtulshi.org", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0 }, { "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "1016M", "suspendreason" : "not suspended", "domain" : "yashjeevanmission.in", "ip" : "51.254.16.113", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "unlimited", "uid" : "2511", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "yashjeevanmissio", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 46179, "max_email_per_hour" : "25", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1751880238, "child_nodes" : [], "startdate" : "25 Jul 07 14:53" }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "bbmakindia.com", "ip" : "51.254.16.113", "diskused" : "1253M", "suspendreason" : "not suspended", "uid" : "2803", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "plan" : "winggolearning_raj", "user" : "bbmakindia", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 67658, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "unix_startdate" : 1773038511, "startdate" : "26 Mar 09 12:11", "child_nodes" : [] }, { "domain" : "shubhkaamnafoundation.in", "ip" : "51.254.16.113", "diskused" : "974M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "plan" : "winggolearning_raj", "user" : "shubhkaamnafound", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "2815", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "inodesused" : 67091, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1773666727, "child_nodes" : [], "startdate" : "26 Mar 16 18:42", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0 }, { "theme" : "jupiter", "uid" : "2572", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "plan" : "winggolearning_raj", "user" : "jansewasiddharth", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "siddharthjansewatrust.in", "diskused" : "1044M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1763811521, "startdate" : "25 Nov 22 17:08", "child_nodes" : [], "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 68829, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "unix_startdate" : 1723543465, "child_nodes" : [], "startdate" : "24 Aug 13 15:34", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 48305, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "acib", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2164", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "diskused" : "2394M", "suspendreason" : "not suspended", "domain" : "acib.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 43040, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "25 Aug 29 20:53", "child_nodes" : [], "unix_startdate" : 1756480996, "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "904M", "domain" : "nationalvolunteerbjp.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "nationalvoluntee", "plan" : "winggolearning_raj", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2348", "theme" : "jupiter" }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 45846, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1754638239, "child_nodes" : [], "startdate" : "25 Aug 08 13:00", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "prakritisanrakshansewasociety.in", "diskused" : "983M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "2382", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "winggolearning_raj", "user" : "prakritisanraksh", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "unix_startdate" : 1678035485, "child_nodes" : [], "startdate" : "23 Mar 05 22:28", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "250M", "has_backup" : 0, "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1166, "max_email_per_hour" : "25", "owner" : "hhtechsolution", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "hhtechsolution_H_Basic", "user" : "amsrinivasaindu", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "1", "uid" : "2594", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "109M", "suspendreason" : "not suspended", "domain" : "srinivasaindustries.net", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "ip" : "51.91.152.238", "domain" : "bstlabour.com", "diskused" : "1460M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "plan" : "thesunda_Metalart2GB", "user" : "bstlabour", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1402", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "max_email_per_hour" : "25", "inodesused" : 9551, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "thesunda", "unix_startdate" : 1719308252, "startdate" : "24 Jun 25 15:07", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "2048M", "email" : "sacretcode@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited" }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "launcheracademy.org", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "22M", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1198", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "user" : "launcheracademy", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 724, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "500M", "startdate" : "18 Apr 12 20:37", "child_nodes" : [], "unix_startdate" : 1523545645 }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 2289, "owner" : "websbook", "suspendtime" : 0, "unix_startdate" : 1466054650, "child_nodes" : [], "startdate" : "16 Jun 16 10:54", "disklimit" : "200M", "has_backup" : 0, "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "diskused" : "171M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "globalhospitalalld.com", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_Linux_100mb", "user" : "globalhospitalal", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "1", "uid" : "1157", "max_emailacct_quota" : "unlimited", "maxftp" : "0" }, { "ip" : "51.254.16.113", "domain" : "gangashridriversassociation.in", "diskused" : "1019M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "plan" : "winggolearning_raj", "user" : "gangashridriver", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "2257", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 46081, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1746519491, "startdate" : "25 May 06 13:48", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited" }, { "inodesused" : 984, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "startdate" : "17 Jul 10 16:18", "child_nodes" : [], "unix_startdate" : 1499683714, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "disklimit" : "500M", "has_backup" : 0, "domain" : "krishnapvtiti.org", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "26M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "krishnaiti", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1, "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "1196", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20" }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "startdate" : "20 Mar 11 15:16", "child_nodes" : [], "unix_startdate" : 1583920013, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 359, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1230", "maxsql" : "1", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "user" : "parakhsocietyorg", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "parakhsociety.org.in", "suspendreason" : "not suspended", "diskused" : "7M" }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "russia-evisacheck.com", "ip" : "51.91.152.238", "diskused" : "29M", "suspendreason" : "not suspended", "uid" : "2872", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "plan" : "apkquest_512mb", "user" : "russiaevisacheck", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "apkquest", "inodesused" : 401, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/usr/local/cpanel/bin/noshell", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "512M", "has_backup" : 0, "unix_startdate" : 1777381712, "child_nodes" : [], "startdate" : "26 Apr 28 18:38" }, { "owner" : "otiyahos", "suspendtime" : 1773301142, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 18859, "max_email_per_hour" : "25", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "agenceotiya@gmail.com", "has_backup" : 0, "disklimit" : "100000M", "maxsub" : "unlimited", "suspended" : 1, "inodeslimit" : "unlimited", "startdate" : "25 Mar 07 22:42", "child_nodes" : [], "unix_startdate" : 1741367528, "maxparked" : "0", "maxaddons" : "10", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "Renouvellement non effectué ", "diskused" : "1535M", "domain" : "oceanfmlolan.tg", "ip" : "51.91.152.238", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "maxsql" : "20", "uid" : "1068", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 1, "user" : "oceanfmlolan", "plan" : "otiyahos_ECO" }, { "diskused" : "937M", "suspendreason" : "not suspended", "domain" : "mekalsutawelfareassociation.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "mekalsutawelfare", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "unlimited", "uid" : "2334", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 44311, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1733916697, "child_nodes" : [], "startdate" : "24 Dec 11 17:01", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1753797082, "child_nodes" : [], "startdate" : "25 Jul 29 19:21", "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 44760, "mailbox_format" : "maildir", "shell" : "/bin/bash", "theme" : "jupiter", "uid" : "2419", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "winggolearning_raj", "user" : "sansarpublicchar", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "sansarpubliccharitablefoundation.in", "diskused" : "909M", "suspendreason" : "not suspended" }, { "ip" : "51.91.152.238", "domain" : "indiragrambharati.org", "suspendreason" : "not suspended", "diskused" : "17M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "indiragr", "plan" : "websbook_Linux_100mb", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "uid" : "1174", "maxsql" : "1", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "max_email_per_hour" : "unlimited", "inodesused" : 785, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "startdate" : "13 Dec 06 21:56", "child_nodes" : [], "unix_startdate" : 1386347204, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "disklimit" : "200M", "has_backup" : 0, "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*" }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "unlimited", "maxaddons" : "unlimited", "domain" : "chennaiwebstores.com", "ip" : "51.91.152.238", "diskused" : "2567M", "suspendreason" : "not suspended", "uid" : "1126", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "plan" : "livechen_Unlimitted", "user" : "chennaiwebstores", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "livechen", "inodesused" : 55465, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home", "outgoing_mail_hold" : 0, "email" : "chennaiwebstore@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "unix_startdate" : 1612538536, "startdate" : "21 Feb 05 20:52", "child_nodes" : [] }, { "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "*unknown*", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1694146155, "startdate" : "23 Sep 08 09:39", "child_nodes" : [], "owner" : "royaldiagnosticc", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "30", "inodesused" : 43196, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "1490", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "royaldiagnosticc_Unlimited plan", "user" : "primehealthdiago", "maxaddons" : "0", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "260M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "primehealthdiagonstic.in" }, { "child_nodes" : [], "startdate" : "24 Sep 21 07:05", "unix_startdate" : 1726882538, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "has_backup" : 0, "disklimit" : "5120M", "inodesused" : 25695, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "apkquest", "user" : "sskhannagirlsdca", "plan" : "apkquest_Site_move5GB", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1384", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "domain" : "sskhannagirlsdc.ac.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "4712M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "unlimited", "maxaddons" : "unlimited" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "dravyafoundation", "plan" : "websbook_linux_500mb", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1141", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "36M", "domain" : "dravyafoundation.in", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "child_nodes" : [], "startdate" : "14 Sep 23 01:09", "unix_startdate" : 1411414757, "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 717, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0 }, { "maxaddons" : "4", "maxparked" : "unlimited", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "Overdue on Payment", "diskused" : "5128M", "ip" : "51.91.152.238", "domain" : "jafedelsu.com", "ipv6" : [], "max_defer_fail_percentage" : "1", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1539", "maxsql" : "unlimited", "outgoing_mail_suspended" : 1, "backup" : 1, "user" : "jafedels", "plan" : "RED13HOSTING", "owner" : "root", "suspendtime" : 1775622611, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 44589, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "officialdovo@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "23 Dec 08 13:27", "unix_startdate" : 1702022273 }, { "unix_startdate" : 1745396206, "startdate" : "25 Apr 23 13:46", "child_nodes" : [], "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 44962, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "realdream", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2393", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "diskused" : "977M", "suspendreason" : "not suspended", "domain" : "realdreamoffoundation.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "thelivingdreams.org", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "808M", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2576", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "user" : "thelivingdreams", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 60709, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "child_nodes" : [], "startdate" : "25 Nov 26 15:55", "unix_startdate" : 1764152717 }, { "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 1761, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "250M", "child_nodes" : [], "startdate" : "22 Jan 29 12:47", "unix_startdate" : 1643440660, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "citrofeelwell.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "127M", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2601", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "citrofeelwell", "plan" : "hhtechsolution_H_Basic", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "ip" : "51.91.152.238", "domain" : "radiolotus.tg", "diskused" : "8204M", "suspendreason" : "Renouvellement non effectué ", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "10", "maxparked" : "0", "plan" : "otiyahos_ECO", "user" : "radiolotus", "backup" : 1, "outgoing_mail_suspended" : 1, "theme" : "jupiter", "uid" : "1062", "maxsql" : "20", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 65465, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 1755757877, "owner" : "otiyahos", "unix_startdate" : 1724079648, "startdate" : "24 Aug 19 20:30", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 1, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "100000M", "outgoing_mail_hold" : 0, "email" : "togolais2008@gmail.com", "partition" : "home", "maxlst" : "unlimited" }, { "plan" : "Red11Backup", "user" : "goldenf1", "outgoing_mail_suspended" : 1, "backup" : 1, "theme" : "jupiter", "uid" : "1052", "maxsql" : "20", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "10", "legacy_backup" : 0, "maxpop" : "unlimited", "ip" : "51.91.152.238", "domain" : "goldenfieldsinfra.com", "diskused" : "19M", "suspendreason" : "Overdue on Payment", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "unix_startdate" : 1709750624, "child_nodes" : [], "startdate" : "24 Mar 07 00:13", "inodeslimit" : "unlimited", "suspended" : 1, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "email" : "somasilakoushik@gmail.com", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 557, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 1741242647, "owner" : "root" }, { "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1474", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "royaldiagnosticc_Unlimited", "user" : "isw", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "iswcentre.in", "diskused" : "150M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "email" : "*unknown*", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1708515240, "startdate" : "24 Feb 21 17:04", "child_nodes" : [], "suspendtime" : 0, "owner" : "royaldiagnosticc", "max_email_per_hour" : "unlimited", "inodesused" : 14585, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "startdate" : "24 Mar 02 13:54", "child_nodes" : [], "unix_startdate" : 1709367849, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 382, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "root", "user" : "server88dl", "plan" : "default", "outgoing_mail_suspended" : 0, "backup" : 1, "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1050", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "domain" : "server88.linux-centos.download", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "11M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "unlimited", "maxaddons" : "unlimited" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 2376, "owner" : "websbook", "suspendtime" : 0, "unix_startdate" : 1385058372, "startdate" : "13 Nov 21 23:56", "child_nodes" : [], "has_backup" : 0, "disklimit" : "200M", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "diskused" : "77M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "nirmalateacherstrainingcollege.org.in", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_Linux_100mb", "user" : "nirmalat", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1224", "maxsql" : "1", "maxftp" : "0", "max_emailacct_quota" : "unlimited" }, { "domain" : "rbsvidhimahavidyalaya.store", "ip" : "51.91.152.238", "diskused" : "1495M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "plan" : "websbook_Unlimited Linux", "user" : "shopkrishna", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "1287", "maxsql" : "15", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "maxpop" : "30", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "inodesused" : 46419, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1704610978, "child_nodes" : [], "startdate" : "24 Jan 07 12:32", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "disklimit" : "unlimited", "has_backup" : 0 }, { "has_backup" : 0, "disklimit" : "200M", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "startdate" : "13 Mar 06 14:06", "child_nodes" : [], "unix_startdate" : 1362558984, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 2784, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1089", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "adssm", "plan" : "websbook_Linux_100mb", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "189M", "ip" : "51.91.152.238", "domain" : "adssmahavidyalaya.org.in" }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "child_nodes" : [], "startdate" : "22 Jan 22 00:57", "unix_startdate" : 1642793243, "suspendtime" : 0, "owner" : "websiteg", "max_email_per_hour" : "25", "inodesused" : 61387, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1167", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "user" : "hostingadmin", "plan" : "websiteg_unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "10", "maxparked" : "unlimited", "ip" : "51.91.152.238", "domain" : "securehosting.group", "suspendreason" : "not suspended", "diskused" : "3784M" }, { "diskused" : "158M", "suspendreason" : "not suspended", "domain" : "api.chennaiwebstores.com", "ip" : "51.91.152.238", "maxparked" : "unlimited", "maxaddons" : "unlimited", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "livechen_Unlimitted", "user" : "api", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "uid" : "1127", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 4923, "max_email_per_hour" : "25", "owner" : "livechen", "suspendtime" : 0, "unix_startdate" : 1685332288, "child_nodes" : [], "startdate" : "23 May 29 09:21", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "diskused" : "1049M", "suspendreason" : "not suspended", "domain" : "watointernational.org", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "watointer", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2504", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 48313, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1743261911, "startdate" : "25 Mar 29 20:55", "child_nodes" : [], "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "200M", "startdate" : "16 Jul 28 16:19", "child_nodes" : [], "unix_startdate" : 1469702977, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 315, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1217", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "user" : "mohdsamigirlsdeg", "plan" : "websbook_Linux_100mb", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "mohdsamigirlsdegreecollege.org", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "14M" }, { "outgoing_mail_suspended" : 1, "backup" : 1, "plan" : "default", "user" : "pawsnmeadmin", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1524", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "diskused" : "4M", "suspendreason" : "Unknown", "ip" : "51.91.152.238", "domain" : "pawsnme.com", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1715604944, "startdate" : "24 May 13 18:25", "child_nodes" : [], "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "onedestinyahead@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 1, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 170, "owner" : "pawsnmei", "suspendtime" : 1767126055 }, { "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2456", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "silverlining", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "961M", "suspendreason" : "not suspended", "domain" : "silverlining.org.in", "ip" : "51.254.16.113", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1728916841, "startdate" : "24 Oct 14 20:10", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 39767, "max_email_per_hour" : "25" }, { "diskused" : "12960M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "skaconcepts.com", "maxaddons" : "unlimited", "maxparked" : "unlimited", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "otiyahos_Pack-Webmaster", "user" : "skaconcepts", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1041", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 21083, "owner" : "otiyahos", "suspendtime" : 0, "unix_startdate" : 1659105091, "child_nodes" : [], "startdate" : "22 Jul 29 20:01", "has_backup" : 0, "disklimit" : "unlimited", "email" : "togolais2008@gmail.com", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited" }, { "suspendreason" : "not suspended", "diskused" : "18M", "domain" : "smritithedesignerstudio.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "wwwsmritithedesi", "plan" : "default", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1061", "maxsql" : "unlimited", "theme" : "jupiter", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 436, "max_email_per_hour" : "unlimited", "owner" : "misakic2", "suspendtime" : 0, "startdate" : "24 Jun 27 16:54", "child_nodes" : [], "unix_startdate" : 1719487492, "maxlst" : "unlimited", "email" : "creationsmisaki@gmail.com", "partition" : "home", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited" }, { "unix_startdate" : 1537070937, "child_nodes" : [], "startdate" : "18 Sep 16 09:38", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "max_email_per_hour" : "25", "inodesused" : 2100, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "plan" : "websbook_linux_500mb", "user" : "jbspatel", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxsql" : "1", "uid" : "1178", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "jbspateldegreecollege.org.in", "diskused" : "43M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "sanjeevtheatreco", "plan" : "websbook_linux_500mb", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1275", "maxsql" : "1", "suspendreason" : "not suspended", "diskused" : "62M", "ip" : "51.91.152.238", "domain" : "indiantheatre.co.in", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "child_nodes" : [], "startdate" : "17 Apr 23 21:58", "unix_startdate" : 1492964901, "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 1119, "owner" : "websbook", "suspendtime" : 0 }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 461, "max_email_per_hour" : "25", "owner" : "hhtechsolution", "suspendtime" : 0, "startdate" : "21 Jan 26 15:45", "child_nodes" : [], "unix_startdate" : 1611656159, "maxlst" : "unlimited", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "250M", "has_backup" : 0, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "19M", "domain" : "scanfinnservicecentre.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "scanfinn", "plan" : "hhtechsolution_H_Basic", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "2659", "theme" : "jupiter" }, { "suspendreason" : "not suspended", "diskused" : "92M", "ip" : "51.91.152.238", "domain" : "etharo.net", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "etharo", "plan" : "hhtechsolution_H_Basic", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "2608", "maxsql" : "1", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 1112, "owner" : "hhtechsolution", "suspendtime" : 0, "child_nodes" : [], "startdate" : "24 Feb 07 11:43", "unix_startdate" : 1707286432, "has_backup" : 0, "disklimit" : "250M", "maxlst" : "unlimited", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1" }, { "ip" : "51.254.16.113", "domain" : "servicensolutions.in", "suspendreason" : "not suspended", "diskused" : "422M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "user" : "servicensolution", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2434", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 16230, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "child_nodes" : [], "startdate" : "25 May 27 18:06", "unix_startdate" : 1748349407, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2" }, { "suspendtime" : 1777514838, "owner" : "hhtechsolution", "inodesused" : 687, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/false", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 1, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited", "disklimit" : "250M", "has_backup" : 0, "unix_startdate" : 1775731784, "child_nodes" : [], "startdate" : "26 Apr 09 16:19", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "rpuktsv.org", "ip" : "51.91.152.238", "diskused" : "57M", "suspendreason" : "Unknown", "uid" : "2849", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "5", "max_defer_fail_percentage" : "30", "ipv6" : [], "plan" : "hhtechsolution_H_Basic", "user" : "rpuktsv", "outgoing_mail_suspended" : 1, "backup" : 1 }, { "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2174", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "winggolearning_raj", "user" : "airea", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "airea.in", "diskused" : "2408M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1734174015, "child_nodes" : [], "startdate" : "24 Dec 14 16:30", "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 46369, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2828", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "plan" : "winggolearning_raj", "user" : "sriwelfareassoci", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "srieducationalwelfareassociation.in", "diskused" : "985M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1774867873, "child_nodes" : [], "startdate" : "26 Mar 30 16:21", "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 67395, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "suspendreason" : "not suspended", "diskused" : "299M", "ip" : "51.91.152.238", "domain" : "drrkpatelcollege.online", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "patelcollege", "plan" : "websbook_Unlimited Linux", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "30", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "15", "uid" : "1233", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 10063, "owner" : "websbook", "suspendtime" : 0, "child_nodes" : [], "startdate" : "24 Dec 26 15:59", "unix_startdate" : 1735208999, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "0", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5" }, { "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2408", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "user" : "sahithi", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "sahithifoundation.org", "suspendreason" : "not suspended", "diskused" : "1067M", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "startdate" : "24 Nov 20 13:46", "child_nodes" : [], "unix_startdate" : 1732090614, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 42557, "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 36363, "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "24 Oct 25 19:20", "child_nodes" : [], "unix_startdate" : 1729864247, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "suspendreason" : "not suspended", "diskused" : "907M", "ip" : "51.254.16.113", "domain" : "vishwakarmapanchalsamaj.in", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "vishwakarma", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2499", "maxsql" : "unlimited" }, { "unix_startdate" : 1520351492, "child_nodes" : [], "startdate" : "18 Mar 06 21:21", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 2125, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "smartjyotish", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxsql" : "1", "uid" : "1302", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "diskused" : "56M", "suspendreason" : "not suspended", "domain" : "smartjyotish.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "suryanshselfless", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2472", "suspendreason" : "not suspended", "diskused" : "1014M", "ip" : "51.254.16.113", "domain" : "suryanshselflesssocial.in", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "startdate" : "25 Apr 28 11:20", "child_nodes" : [], "unix_startdate" : 1745819448, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 45165, "owner" : "winggolearning", "suspendtime" : 0 }, { "has_backup" : 0, "disklimit" : "250M", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "unix_startdate" : 1731344630, "child_nodes" : [], "startdate" : "24 Nov 11 22:33", "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 4984, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "1", "uid" : "2678", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "hhtechsolution_H_Basic", "user" : "waterpurifierban", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "58M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "waterpurifierbangalore.com" }, { "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2558", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "1", "ipv6" : [], "user" : "srkramci", "plan" : "RED13HOSTING", "backup" : 1, "outgoing_mail_suspended" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "4", "maxparked" : "unlimited", "domain" : "srkramc.in", "ip" : "51.91.152.238", "suspendreason" : "MALICIOUS CRON/PROCESS", "diskused" : "5462M", "maxsub" : "unlimited", "suspended" : 1, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "anilreddy8739@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "startdate" : "24 Nov 26 09:50", "child_nodes" : [], "unix_startdate" : 1732594854, "suspendtime" : 1763187077, "owner" : "root", "inodesused" : 244734, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "unix_startdate" : 1757144605, "child_nodes" : [], "startdate" : "25 Sep 06 13:13", "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 43417, "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "parmahansafounda", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2371", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "diskused" : "893M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "ramakrishnaparmahansafoundation.in", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "ip" : "51.254.16.113", "domain" : "dduy.in", "suspendreason" : "not suspended", "diskused" : "1M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "user" : "dduy", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2704", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 100, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "25 Dec 13 15:16", "child_nodes" : [], "unix_startdate" : 1765619186, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0 }, { "theme" : "jupiter", "uid" : "2240", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "winggolearning_raj", "user" : "divyapitambarafo", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "divyapitambarafoundation.com", "diskused" : "883M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1756372855, "child_nodes" : [], "startdate" : "25 Aug 28 14:50", "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 42472, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 34653, "owner" : "apkquest", "suspendtime" : 0, "child_nodes" : [], "startdate" : "25 Feb 10 15:16", "unix_startdate" : 1739180762, "disklimit" : "1024M", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "suspendreason" : "not suspended", "diskused" : "422M", "ip" : "51.91.152.238", "domain" : "letsprintz.com", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "letsprintz", "plan" : "apkquest_1gb", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1368", "maxsql" : "unlimited" }, { "plan" : "winggolearning_raj", "user" : "himalyanbharti", "outgoing_mail_suspended" : 0, "backup" : 1, "maxsql" : "unlimited", "uid" : "2270", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "himalyanbharti.com", "ip" : "51.254.16.113", "diskused" : "1233M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "unix_startdate" : 1739176466, "child_nodes" : [], "startdate" : "25 Feb 10 14:04", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 67473, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "rs1672457", "plan" : "otiyahos_ECO", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "uid" : "1038", "maxsql" : "20", "suspendreason" : "not suspended", "diskused" : "227M", "ip" : "51.91.152.238", "domain" : "otiyahosting.com", "maxparked" : "0", "maxaddons" : "10", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "child_nodes" : [], "startdate" : "21 Aug 05 01:47", "unix_startdate" : 1628108266, "has_backup" : 0, "disklimit" : "100000M", "maxlst" : "unlimited", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "50", "inodesused" : 14036, "owner" : "otiyahos", "suspendtime" : 0 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "thesunda_cine1024", "user" : "ramsonstools", "maxpop" : "3", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "uid" : "1971", "maxsql" : "5", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "diskused" : "686M", "suspendreason" : "not suspended", "domain" : "ramsonstools.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1752037164, "child_nodes" : [], "startdate" : "25 Jul 09 10:29", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "sacretcode@gmail.com", "maxlst" : "0", "disklimit" : "1024M", "has_backup" : 0, "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 22037, "max_email_per_hour" : "25", "owner" : "thesunda", "suspendtime" : 0 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "thesunda_cine1024", "user" : "themptpa", "legacy_backup" : 1, "maxpop" : "3", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "uid" : "1437", "maxsql" : "5", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "diskused" : "512M", "suspendreason" : "not suspended", "domain" : "themptpa.in", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1714812887, "child_nodes" : [], "startdate" : "24 May 04 14:24", "email" : "sacretcode@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "0", "disklimit" : "1024M", "has_backup" : 0, "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 16511, "max_email_per_hour" : "25", "owner" : "thesunda", "suspendtime" : 0 }, { "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "1258", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "user" : "rnpandeylawcolle", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "rnpandeylawcollege.org.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "386M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "disklimit" : "500M", "has_backup" : 0, "startdate" : "19 Nov 06 21:43", "child_nodes" : [], "unix_startdate" : 1573056793, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 2284, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2718", "maxsql" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "salkwtal", "plan" : "winggolearning_raj", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "14301M", "ip" : "51.254.16.113", "domain" : "salkwtal.org", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "25 Dec 25 20:10", "unix_startdate" : 1766673642, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 86624 }, { "child_nodes" : [], "startdate" : "25 Oct 26 18:42", "unix_startdate" : 1761484360, "maxlst" : "unlimited", "email" : "Kishanraja48@Gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "50200M", "maxsub" : "unlimited", "suspended" : 1, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 5464, "max_email_per_hour" : "25", "owner" : "filmywap", "suspendtime" : 1761551736, "outgoing_mail_suspended" : 1, "backup" : 1, "user" : "filmy4wap", "plan" : "default", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2542", "maxsql" : "unlimited", "theme" : "jupiter", "suspendreason" : "Overdue on Payment", "diskused" : "803M", "domain" : "filmy4wap.rest", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0 }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 14171, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1675434572, "child_nodes" : [], "startdate" : "23 Feb 03 19:59", "has_backup" : 0, "disklimit" : "10000M", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "diskused" : "951M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "apanahoteldiu.in", "maxparked" : "0", "maxaddons" : "5", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "root_raj", "user" : "apanahoteldiu", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2180", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited" }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "gdcmanikpur.org", "suspendreason" : "not suspended", "diskused" : "323M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1154", "maxsql" : "1", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "user" : "gdcmanikpur", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 2653, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "child_nodes" : [], "startdate" : "17 Oct 20 16:10", "unix_startdate" : 1508496029 }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "has_backup" : 0, "disklimit" : "250M", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "child_nodes" : [], "startdate" : "22 Jul 30 08:32", "unix_startdate" : 1659150138, "suspendtime" : 0, "owner" : "hhtechsolution", "max_email_per_hour" : "25", "inodesused" : 899, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2590", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "5", "legacy_backup" : 1, "user" : "alacrious", "plan" : "hhtechsolution_H_Basic", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "alacrious.com", "suspendreason" : "not suspended", "diskused" : "109M" }, { "plan" : "websbook_linux_500mb", "user" : "prayagcitizenlaw", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "1239", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "ip" : "51.91.152.238", "domain" : "prayagcitizenlawcollege.org", "diskused" : "101M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "unix_startdate" : 1573057480, "child_nodes" : [], "startdate" : "19 Nov 06 21:54", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "max_email_per_hour" : "25", "inodesused" : 1090, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook" }, { "suspendtime" : 0, "owner" : "apkquest", "max_email_per_hour" : "50", "inodesused" : 980, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "10", "disklimit" : "250M", "has_backup" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "5", "unix_startdate" : 1727927022, "startdate" : "24 Oct 03 09:13", "child_nodes" : [], "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "kppharmacyprayagraj.com", "diskused" : "53M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "1364", "maxsql" : "10", "maxftp" : "5", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "10", "ipv6" : [], "maxpop" : "15", "legacy_backup" : 1, "plan" : "apkquest_250mb", "user" : "kppharmacyprayag", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "uid" : "2359", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "plan" : "winggolearning_raj", "user" : "nhrcoct", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "nhrcoct.in", "ip" : "51.254.16.113", "diskused" : "1031M", "suspendreason" : "not suspended", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "unix_startdate" : 1756122508, "child_nodes" : [], "startdate" : "25 Aug 25 17:18", "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 47619, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "ipv6" : [], "max_defer_fail_percentage" : "1", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1980", "maxsql" : "unlimited", "outgoing_mail_suspended" : 1, "backup" : 1, "user" : "creativ2", "plan" : "RED13HOSTING", "maxaddons" : "4", "maxparked" : "unlimited", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "Overdue on Payment", "diskused" : "11463M", "ip" : "51.91.152.238", "domain" : "creativtechie.com", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "hariprasanna2210@gmail.com", "partition" : "home2", "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "24 Oct 30 07:18", "unix_startdate" : 1730252912, "owner" : "root", "suspendtime" : 1762065016, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 109225 }, { "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "helpingbrigadefoundation.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1224M", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2870", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "helpingbrigadefo", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 67572, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "child_nodes" : [], "startdate" : "26 Apr 28 13:37", "unix_startdate" : 1777363679 }, { "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "3", "startdate" : "15 Nov 12 11:36", "child_nodes" : [], "unix_startdate" : 1447308391, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 2629, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "3", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1284", "maxsql" : "2", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "sgvmalld", "plan" : "websbook_linux_500 mb_second", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "158M", "ip" : "51.91.152.238", "domain" : "sgvmalld.org.in" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "undefined", "user" : "bizzbasket", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "uid" : "1351", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "diskused" : "1598M", "suspendreason" : "not suspended", "domain" : "bizzbasket.com", "ip" : "51.91.152.238", "maxaddons" : "5", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1724772097, "startdate" : "24 Aug 27 20:51", "child_nodes" : [], "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "2000M", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 125102, "max_email_per_hour" : "unlimited", "owner" : "apkquest", "suspendtime" : 0 }, { "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "ramsonsindustries.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "154M", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "5", "uid" : "1427", "theme" : "jupiter", "maxpop" : "3", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "user" : "ramsonsindus", "plan" : "thesunda_cine1024", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "thesunda", "inodesused" : 6178, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "sacretcode@gmail.com", "disklimit" : "1024M", "has_backup" : 0, "startdate" : "24 Aug 24 11:02", "child_nodes" : [], "unix_startdate" : 1724477542 }, { "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "130M", "ip" : "51.91.152.238", "domain" : "suchitanandanmahavidyalaya.org", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "uid" : "1316", "maxsql" : "1", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "suchitanandanmah", "plan" : "websbook_Linux_100mb", "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 932, "has_backup" : 0, "disklimit" : "200M", "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "startdate" : "23 Sep 28 14:20", "child_nodes" : [], "unix_startdate" : 1695891005 }, { "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2466", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "winggolearning_raj", "user" : "ssjm", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "ssjm.in", "diskused" : "4179M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1736509221, "startdate" : "25 Jan 10 17:10", "child_nodes" : [], "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 79222, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "uid" : "1013", "maxsql" : "20", "backup" : 1, "outgoing_mail_suspended" : 1, "user" : "ange", "plan" : "otiyahos_ECO", "maxaddons" : "10", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "Payement en retard", "diskused" : "2437M", "ip" : "51.91.152.238", "domain" : "ange.tg", "has_backup" : 0, "disklimit" : "100000M", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "togolais2008@gmail.com", "partition" : "home", "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "23 Apr 22 17:34", "child_nodes" : [], "unix_startdate" : 1682165052, "owner" : "otiyahos", "suspendtime" : 1712295983, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 19888 }, { "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "has_backup" : 0, "disklimit" : "5000M", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "20", "unix_startdate" : 1713355136, "startdate" : "24 Apr 17 17:28", "child_nodes" : [], "suspendtime" : 0, "owner" : "hhtechsolution", "max_email_per_hour" : "25", "inodesused" : 669, "mailbox_format" : "maildir", "shell" : "/bin/bash", "theme" : "jupiter", "maxsql" : "5", "uid" : "2598", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "20", "plan" : "hhtechsolution_Adv-5GB", "user" : "atharvfz", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "atharvfz.com", "diskused" : "273M", "suspendreason" : "not suspended" }, { "startdate" : "25 Jun 03 18:25", "child_nodes" : [], "unix_startdate" : 1748955347, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 45193, "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "ngoekkoshish", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2355", "maxsql" : "unlimited", "suspendreason" : "not suspended", "diskused" : "934M", "ip" : "51.254.16.113", "domain" : "ngoekkoshishwelfare.in", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0 }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "startdate" : "25 Aug 07 16:55", "child_nodes" : [], "unix_startdate" : 1754565913, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 46814, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2460", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "user" : "smkrct", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "smkrct.in", "suspendreason" : "not suspended", "diskused" : "947M" }, { "suspendtime" : 0, "owner" : "royaldiagnosticc", "inodesused" : 20154, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "child_nodes" : [], "startdate" : "24 Feb 22 11:23", "unix_startdate" : 1708581192, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "neemcare.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "389M", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1485", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "user" : "neem", "plan" : "royaldiagnosticc_Unlimited", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "diskused" : "3502M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "chennai.bid", "maxaddons" : "20", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "default", "user" : "chennai", "max_defer_fail_percentage" : "5", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "1119", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "50", "inodesused" : 72988, "owner" : "websiteg", "suspendtime" : 0, "unix_startdate" : 1561857906, "startdate" : "19 Jun 30 06:55", "child_nodes" : [], "has_backup" : 0, "disklimit" : "100000M", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "shivatrust", "plan" : "winggolearning_raj", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2742", "maxsql" : "unlimited", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "2077M", "domain" : "shivatrust.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "startdate" : "26 Jan 12 11:47", "child_nodes" : [], "unix_startdate" : 1768198629, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 80441, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "prayagra", "plan" : "websbook_linux_500mb", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1240", "maxsql" : "1", "suspendreason" : "not suspended", "diskused" : "348M", "ip" : "51.91.152.238", "domain" : "prayagrajpublicschool.com", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "startdate" : "13 Feb 19 21:19", "child_nodes" : [], "unix_startdate" : 1361288953, "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 2369, "owner" : "websbook", "suspendtime" : 0 }, { "plan" : "winggolearning_raj", "user" : "garibasathi", "outgoing_mail_suspended" : 0, "backup" : 1, "maxsql" : "unlimited", "uid" : "2258", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "garibasathifoundation.com", "ip" : "51.254.16.113", "diskused" : "935M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "unix_startdate" : 1723637858, "child_nodes" : [], "startdate" : "24 Aug 14 17:47", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 40448, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning" }, { "suspendreason" : "not suspended", "diskused" : "732M", "ip" : "51.254.16.113", "domain" : "classicinterior.co.in", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "classicinterior", "plan" : "default", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2217", "maxsql" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "70", "inodesused" : 13092, "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "23 May 16 20:25", "child_nodes" : [], "unix_startdate" : 1684248953, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited" }, { "unix_startdate" : 1751975788, "child_nodes" : [], "startdate" : "25 Jul 08 17:26", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 46088, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "plan" : "winggolearning_raj", "user" : "janjagritifound", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "2292", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "janjagritifoundations.org", "ip" : "51.254.16.113", "diskused" : "938M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1" }, { "suspendreason" : "not suspended", "diskused" : "1040M", "domain" : "jeevandoot.org.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "jeevandoot", "plan" : "winggolearning_raj", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2298", "maxsql" : "unlimited", "theme" : "jupiter", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 43623, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "25 Sep 25 11:45", "child_nodes" : [], "unix_startdate" : 1758780952, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited" }, { "maxsub" : "unlimited", "suspended" : 1, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited", "startdate" : "25 May 03 10:02", "child_nodes" : [], "unix_startdate" : 1746246747, "suspendtime" : 1777887042, "owner" : "winggolearning", "inodesused" : 48543, "max_email_per_hour" : "25", "shell" : "/bin/false", "mailbox_format" : "maildir", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2231", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "user" : "devishanti", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 1, "backup" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "shantidevifoundation.com", "ip" : "51.254.16.113", "suspendreason" : "Unknown", "diskused" : "1316M" }, { "plan" : "default", "user" : "bharattext", "outgoing_mail_suspended" : 0, "backup" : 1, "maxsql" : "unlimited", "uid" : "1070", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "domain" : "bharattext.in", "ip" : "51.91.152.238", "diskused" : "246M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "unix_startdate" : 1739463548, "child_nodes" : [], "startdate" : "25 Feb 13 21:49", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home", "outgoing_mail_hold" : 0, "email" : "bharatmedia1019@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 11775, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "niipmcom" }, { "unix_startdate" : 1757410858, "startdate" : "25 Sep 09 15:10", "child_nodes" : [], "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 59693, "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "saaditrust", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2402", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "diskused" : "804M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "saaditrust.com", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 42363, "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1759140182, "child_nodes" : [], "startdate" : "25 Sep 29 15:33", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "957M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "skyhelporganisation.in", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2459", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "skyhelporganisat" }, { "child_nodes" : [], "startdate" : "22 Oct 10 10:45", "unix_startdate" : 1665378919, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "250M", "has_backup" : 0, "inodesused" : 947, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "hhtechsolution", "user" : "golgothamission", "plan" : "hhtechsolution_H_Basic", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2612", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "golgothamission.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "116M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0" }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "adarshpvtiti.org", "diskused" : "19M", "suspendreason" : "not suspended", "theme" : "jupiter", "maxsql" : "1", "uid" : "1087", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "plan" : "websbook_Linux_100mb", "user" : "adarshpvtiti", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "unlimited", "inodesused" : 840, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "has_backup" : 0, "disklimit" : "200M", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "unix_startdate" : 1506355955, "startdate" : "17 Sep 25 21:42", "child_nodes" : [] }, { "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "maxsql" : "20", "uid" : "1045", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "togoscoop", "plan" : "otiyahos_ECO", "maxparked" : "0", "maxaddons" : "10", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "34015M", "ip" : "51.91.152.238", "domain" : "togoscoop.info", "disklimit" : "100000M", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "togolais2008@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "22 Jun 24 13:04", "child_nodes" : [], "unix_startdate" : 1656056078, "owner" : "otiyahos", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 224742 }, { "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1770893666, "startdate" : "26 Feb 12 16:24", "child_nodes" : [], "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 75775, "mailbox_format" : "maildir", "shell" : "/bin/bash", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2779", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "plan" : "winggolearning_raj", "user" : "sankalphumanwelf", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "sankalphumanwelfarefoundation.in", "diskused" : "881M", "suspendreason" : "not suspended" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "shivpvtitico", "plan" : "websbook_linux_500mb", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1286", "maxsql" : "1", "suspendreason" : "not suspended", "diskused" : "9M", "ip" : "51.91.152.238", "domain" : "shivpvtiti.co.in", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "startdate" : "19 Mar 29 21:22", "child_nodes" : [], "unix_startdate" : 1553874777, "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 373, "owner" : "websbook", "suspendtime" : 0 }, { "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "child_nodes" : [], "startdate" : "13 Mar 02 13:20", "unix_startdate" : 1362210656, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 1610, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1117", "maxsql" : "1", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "btcbalra", "plan" : "websbook_linux_500mb", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "53M", "ip" : "51.91.152.238", "domain" : "btcbalrammahavidyalaya.org" }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "email" : "*unknown*", "partition" : "home2", "outgoing_mail_hold" : 0, "child_nodes" : [], "startdate" : "26 Jan 29 23:45", "unix_startdate" : 1769710510, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 295, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2760", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "5", "user" : "uttkalppsansthao", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "uttkalkppsanstha.org.in", "suspendreason" : "not suspended", "diskused" : "15M" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "bombayfineartigd", "plan" : "websbook_linux_500mb", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1112", "maxsql" : "1", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "82M", "domain" : "bombayfineartigd.org", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "child_nodes" : [], "startdate" : "18 Mar 07 18:00", "unix_startdate" : 1520425800, "maxlst" : "0", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 766, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0 }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "balrammahavidyalayaagri.org", "diskused" : "46M", "suspendreason" : "not suspended", "theme" : "jupiter", "maxsql" : "1", "uid" : "1102", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "plan" : "websbook_Linux_100mb", "user" : "balaag", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "unlimited", "inodesused" : 1246, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "disklimit" : "200M", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "0", "unix_startdate" : 1362210843, "child_nodes" : [], "startdate" : "13 Mar 02 13:24" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "hargovindagroipl", "plan" : "websbook_1000 MB Linux", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1166", "maxsql" : "2", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "952M", "domain" : "hargovindagroipl.com", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "child_nodes" : [], "startdate" : "22 Jan 26 15:26", "unix_startdate" : 1643190964, "maxlst" : "1", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "1000M", "maxsub" : "3", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 9420, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0 }, { "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2768", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "vizitonindiawelf", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "871M", "suspendreason" : "not suspended", "domain" : "vizitonindiawelfarefoundation.in", "ip" : "51.254.16.113", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1770384318, "startdate" : "26 Feb 06 18:55", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 67094, "max_email_per_hour" : "25" }, { "inodesused" : 1280, "max_email_per_hour" : "50", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "apkquest", "startdate" : "24 Oct 03 09:20", "child_nodes" : [], "unix_startdate" : 1727927458, "maxsub" : "10", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "5", "email" : "*unknown*", "partition" : "home2", "outgoing_mail_hold" : 0, "disklimit" : "250M", "has_backup" : 0, "domain" : "kpucchashiksha.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "149M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "kpucchashiksha", "plan" : "apkquest_250mb", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "5", "max_emailacct_quota" : "unlimited", "uid" : "1366", "maxsql" : "10", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "15", "ipv6" : [], "max_defer_fail_percentage" : "10" }, { "child_nodes" : [], "startdate" : "17 May 06 13:35", "unix_startdate" : 1494057953, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "max_email_per_hour" : "25", "inodesused" : 1733, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "user" : "panchsheelhospit", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "1226", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "panchsheelhospital.com", "suspendreason" : "not suspended", "diskused" : "57M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 15922, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1717144045, "child_nodes" : [], "startdate" : "24 May 31 13:57", "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "diskused" : "648M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "idealinterio.in", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "idealinterio", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2282", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited" }, { "unix_startdate" : 1727597671, "startdate" : "24 Sep 29 13:44", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "5120M", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "shiv2144@gmail.com", "maxlst" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 38155, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "apkquest", "plan" : "apkquest_Site_move5GB", "user" : "tpsallahabad", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "2564", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "tpsallahabad.com", "diskused" : "2354M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "unlimited", "maxaddons" : "unlimited" }, { "suspendtime" : 1764138717, "owner" : "root", "inodesused" : 7955, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 1, "outgoing_mail_hold" : 0, "email" : "surajaggarwal38@yahoo.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1701004674, "startdate" : "23 Nov 26 18:47", "child_nodes" : [], "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "unlimited", "maxaddons" : "4", "domain" : "growthfox.in", "ip" : "51.91.152.238", "diskused" : "154M", "suspendreason" : "Overdue on Payment", "uid" : "1548", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "1", "ipv6" : [], "plan" : "RED13HOSTING", "user" : "growthfo", "backup" : 1, "outgoing_mail_suspended" : 1 }, { "diskused" : "1270M", "suspendreason" : "not suspended", "domain" : "rise-care.org", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "risecare", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2868", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 66387, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1777096913, "startdate" : "26 Apr 25 11:31", "child_nodes" : [], "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 47649, "max_email_per_hour" : "25", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1756815728, "child_nodes" : [], "startdate" : "25 Sep 02 17:52", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1245M", "suspendreason" : "not suspended", "domain" : "aieaonline.in", "ip" : "51.254.16.113", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2173", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "aieaonline" }, { "suspendreason" : "not suspended", "diskused" : "52M", "domain" : "vertigeshare.in", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "vertigeshare", "plan" : "websbook_1000 MB Linux", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "2", "uid" : "1332", "theme" : "jupiter", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 3344, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0, "child_nodes" : [], "startdate" : "16 Oct 19 19:55", "unix_startdate" : 1476887110, "maxlst" : "1", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "1000M", "maxsub" : "3", "suspended" : 0, "inodeslimit" : "unlimited" }, { "theme" : "jupiter", "uid" : "1970", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "unlimited", "plan" : "skystechnology_skystech_premium_ornests", "user" : "kristal2025", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "5", "maxparked" : "5", "ip" : "51.91.152.238", "domain" : "kristalengg.com", "diskused" : "424M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "admin@kristalengg.com", "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1752032741, "startdate" : "25 Jul 09 09:15", "child_nodes" : [], "suspendtime" : 0, "owner" : "skystechnology", "max_email_per_hour" : "25", "inodesused" : 16550, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "startdate" : "16 Jul 04 18:34", "child_nodes" : [], "unix_startdate" : 1467637476, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 439, "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1292", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "shritaratravels", "plan" : "websbook_linux_500mb", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "14M", "ip" : "51.91.152.238", "domain" : "shritaratravels.com" }, { "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "25", "disklimit" : "1000M", "has_backup" : 0, "unix_startdate" : 1683535631, "child_nodes" : [], "startdate" : "23 May 08 14:17", "suspendtime" : 0, "owner" : "topweblogic", "inodesused" : 24048, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsql" : "2", "uid" : "2524", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "10", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "plan" : "topweblogic_Silver Package", "user" : "imbuecrest", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "imbuecrest.co.za", "ip" : "51.91.152.238", "diskused" : "821M", "suspendreason" : "not suspended" }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 44840, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "startdate" : "24 Jun 21 11:42", "child_nodes" : [], "unix_startdate" : 1718950353, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "bhavadhas.com", "suspendreason" : "not suspended", "diskused" : "984M", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2204", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "user" : "bhavadhas", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "suspendtime" : 0, "owner" : "topweblogic", "inodesused" : 32795, "max_email_per_hour" : "*unknown*", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "topweblogic@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1699433715, "startdate" : "23 Nov 08 14:25", "child_nodes" : [], "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "domain" : "hddtechnologies.com", "ip" : "51.91.152.238", "diskused" : "1393M", "suspendreason" : "not suspended", "maxsql" : "unlimited", "uid" : "2146", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "plan" : "default", "user" : "websitehdd", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1764837245, "child_nodes" : [], "startdate" : "25 Dec 04 14:04", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 60105, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2581", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "udaanfoundation", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "778M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "shikshaudaanfoundation.org" }, { "unix_startdate" : 1452529325, "startdate" : "16 Jan 11 21:52", "child_nodes" : [], "has_backup" : 0, "disklimit" : "500M", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 1513, "owner" : "websbook", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "santinstitute", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "1", "uid" : "1276", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "diskused" : "96M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "santsinghinstitute.org", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "suspendtime" : 0, "owner" : "websbook", "inodesused" : 496, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "disklimit" : "200M", "has_backup" : 0, "unix_startdate" : 1472498812, "child_nodes" : [], "startdate" : "16 Aug 30 00:56", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "domain" : "vpvpmahavidyalaya.org", "ip" : "51.91.152.238", "diskused" : "10M", "suspendreason" : "not suspended", "maxsql" : "1", "uid" : "1339", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "websbook_Linux_100mb", "user" : "vpvpmahavidyalay", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "user" : "shrikunjbihari", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2449", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.254.16.113", "domain" : "shrikunjbiharicharitabletrust.in", "suspendreason" : "not suspended", "diskused" : "972M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "startdate" : "25 May 23 13:02", "child_nodes" : [], "unix_startdate" : 1747985546, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "max_email_per_hour" : "25", "inodesused" : 45102, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "2", "uid" : "1146", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [], "user" : "dsmmv", "plan" : "websbook_1000 MB Linux", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "dsmmv.org", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "109M", "maxsub" : "3", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "1", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "disklimit" : "1000M", "has_backup" : 0, "startdate" : "16 Sep 29 18:34", "child_nodes" : [], "unix_startdate" : 1475154267, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 497, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "suspendreason" : "not suspended", "diskused" : "1722M", "ip" : "51.254.16.113", "domain" : "onhumanrights.org.in", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "onhumanrights", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2365", "maxsql" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 83175, "owner" : "winggolearning", "suspendtime" : 0, "child_nodes" : [], "startdate" : "25 Feb 13 13:34", "unix_startdate" : 1739433863, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited" }, { "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 39110, "max_email_per_hour" : "25", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Nov 27 16:49", "unix_startdate" : 1732706381, "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1015M", "domain" : "divyadhamaasthatrust.in", "ip" : "51.254.16.113", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2239", "maxsql" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "divyadhamaastha", "plan" : "winggolearning_raj" }, { "disklimit" : "250M", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "partition" : "home2", "maxlst" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "10", "unix_startdate" : 1763969294, "startdate" : "25 Nov 24 12:58", "child_nodes" : [], "owner" : "apkquest", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 256, "max_defer_fail_percentage" : "10", "ipv6" : [], "maxpop" : "15", "legacy_backup" : 0, "theme" : "jupiter", "uid" : "2574", "maxsql" : "10", "max_emailacct_quota" : "unlimited", "maxftp" : "5", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "apkquest_250mb", "user" : "thelegalfirst", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "8M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "thelegalfirst.com" }, { "uid" : "1236", "maxsql" : "2", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "10", "ipv6" : [], "max_defer_fail_percentage" : "20", "plan" : "websbook_linux_2000mb", "user" : "plpublicschool", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "domain" : "plpublicschool.org.in", "ip" : "51.91.152.238", "diskused" : "431M", "suspendreason" : "not suspended", "maxsub" : "10", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "10", "disklimit" : "2000M", "has_backup" : 0, "unix_startdate" : 1744737357, "startdate" : "25 Apr 15 22:45", "child_nodes" : [], "suspendtime" : 0, "owner" : "websbook", "inodesused" : 39879, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1298", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "20", "user" : "site", "plan" : "livechen_Unlimitted", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "unlimited", "maxparked" : "unlimited", "domain" : "sites.chennaiwebstores.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "252M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "chennaiwebstore@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "child_nodes" : [], "startdate" : "24 Oct 02 20:56", "unix_startdate" : 1727882762, "suspendtime" : 0, "owner" : "livechen", "inodesused" : 5212, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "plan" : "websbook_linux_500mb", "user" : "meenatiwarilawco", "backup" : 1, "outgoing_mail_suspended" : 1, "theme" : "jupiter", "uid" : "2764", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 0, "ip" : "51.91.152.238", "domain" : "meenatiwarilawcollege.org.in", "diskused" : "19M", "suspendreason" : "Bill Due", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "unix_startdate" : 1769976769, "child_nodes" : [], "startdate" : "26 Feb 02 01:42", "inodeslimit" : "unlimited", "suspended" : 1, "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "email" : "*unknown*", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "0", "max_email_per_hour" : "25", "inodesused" : 284, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 1773302182, "owner" : "websbook" }, { "owner" : "apkquest", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 1208, "max_email_per_hour" : "50", "maxlst" : "5", "partition" : "home2", "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "250M", "maxsub" : "10", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "24 Dec 08 13:56", "child_nodes" : [], "unix_startdate" : 1733646373, "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "96M", "domain" : "sankirtancollege.com", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "15", "max_defer_fail_percentage" : "10", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "5", "maxsql" : "10", "uid" : "1375", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "sankirtancollege", "plan" : "apkquest_250mb" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 68108, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "child_nodes" : [], "startdate" : "26 Apr 09 15:45", "unix_startdate" : 1775729700, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "1029M", "domain" : "praharrajfoundation.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "praharrajfoundat", "plan" : "winggolearning_raj", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2848", "theme" : "jupiter" }, { "suspendreason" : "not suspended", "diskused" : "882M", "domain" : "thawevidyapeeth.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "thawevidyapeeth", "plan" : "winggolearning_raj", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2479", "theme" : "jupiter", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 31695, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "24 Jul 01 14:47", "child_nodes" : [], "unix_startdate" : 1719825469, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited" }, { "user" : "ektasevasociety", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2245", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "ektasevasociety.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "935M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "startdate" : "25 Jul 14 16:14", "child_nodes" : [], "unix_startdate" : 1752489871, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 45791, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "sfaid", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2437", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "diskused" : "657M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "sfaid.in", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1751011060, "startdate" : "25 Jun 27 13:27", "child_nodes" : [], "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 39852, "owner" : "winggolearning", "suspendtime" : 0 }, { "uid" : "2606", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "10", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "hhtechsolution_H_Adv", "user" : "drlathashekhar", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "domain" : "drlathashekhar.com", "ip" : "51.91.152.238", "diskused" : "614M", "suspendreason" : "not suspended", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "maxlst" : "1", "disklimit" : "1500M", "has_backup" : 0, "unix_startdate" : 1645247304, "child_nodes" : [], "startdate" : "22 Feb 19 10:38", "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 8067, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "10", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1341", "maxsql" : "2", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_2000mb", "user" : "websofttechnolog", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "178M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "websofttechnologiesindia.com", "has_backup" : 0, "disklimit" : "2000M", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "10", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "10", "unix_startdate" : 1557999392, "startdate" : "19 May 16 15:06", "child_nodes" : [], "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 16622 }, { "unix_startdate" : 1721821532, "child_nodes" : [], "startdate" : "24 Jul 24 17:15", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 30199, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "plan" : "winggolearning_raj", "user" : "savitribaiphule", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "unlimited", "uid" : "2428", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "savitribaiphulesamgravikassanstha.in", "ip" : "51.254.16.113", "diskused" : "850M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1" }, { "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2255", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "user" : "froti", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "rotifoundation.co.in", "suspendreason" : "not suspended", "diskused" : "991M", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "child_nodes" : [], "startdate" : "25 Aug 05 13:29", "unix_startdate" : 1754380774, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 44664, "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "unlimited", "uid" : "2288", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "isjmt", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1106M", "suspendreason" : "not suspended", "domain" : "isjmt.org.in", "ip" : "51.254.16.113", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1745411101, "startdate" : "25 Apr 23 17:55", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 50276, "max_email_per_hour" : "25" }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "disklimit" : "250M", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "startdate" : "21 Oct 31 17:21", "child_nodes" : [], "unix_startdate" : 1635681089, "suspendtime" : 0, "owner" : "hhtechsolution", "max_email_per_hour" : "25", "inodesused" : 1539, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2671", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "5", "legacy_backup" : 1, "user" : "topfreightlogist", "plan" : "hhtechsolution_H_Basic", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "topfreightlogistics.in", "suspendreason" : "not suspended", "diskused" : "85M" }, { "suspendreason" : "Payement en retard", "diskused" : "1627M", "ip" : "51.91.152.238", "domain" : "centaurecommunication.tg", "maxparked" : "0", "maxaddons" : "10", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 1, "user" : "centaure", "plan" : "otiyahos_ECO", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "uid" : "1018", "maxsql" : "20", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 27984, "owner" : "otiyahos", "suspendtime" : 1717619340, "startdate" : "21 Jul 05 14:09", "child_nodes" : [], "unix_startdate" : 1625474340, "disklimit" : "100000M", "has_backup" : 0, "maxlst" : "unlimited", "email" : "togolais2008@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home", "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 8113, "max_email_per_hour" : "25", "owner" : "thesunda", "suspendtime" : 0, "child_nodes" : [], "startdate" : "25 Mar 05 11:00", "unix_startdate" : 1741152639, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "sacretcode@gmail.com", "has_backup" : 0, "disklimit" : "2048M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "594M", "domain" : "shikkshaekabhiyan.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "shikksha", "plan" : "thesunda_Metalart2GB", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1435", "theme" : "jupiter" }, { "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "10", "theme" : "jupiter", "maxsql" : "2", "uid" : "2118", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "topweblogic_Silver Package", "user" : "engineerings", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "783M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "dynamicengineerings.in", "disklimit" : "1000M", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "topweblogic@gmail.com", "maxlst" : "25", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "unix_startdate" : 1748422475, "startdate" : "25 May 28 14:24", "child_nodes" : [], "owner" : "topweblogic", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 21036 }, { "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1142", "maxsql" : "1", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "drbrambe", "plan" : "websbook_linux_500mb", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "319M", "ip" : "51.91.152.238", "domain" : "drbrambedkarmahavidyalaya.org.in", "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "startdate" : "13 Mar 02 20:24", "child_nodes" : [], "unix_startdate" : 1362236050, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 1927 }, { "user" : "sgtresearchfound", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2757", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "sgtresearchfoundation.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "733M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "startdate" : "26 Jan 29 14:15", "child_nodes" : [], "unix_startdate" : 1769676348, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 63379, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "unix_startdate" : 1735205795, "startdate" : "24 Dec 26 15:06", "child_nodes" : [], "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 41771, "owner" : "winggolearning", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "yuvajagritimanch", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2515", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "diskused" : "1128M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "yuvajagritimanch.in", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2176", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "alayanwelfare", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1006M", "suspendreason" : "not suspended", "domain" : "himalayanwelfarefoundation.in", "ip" : "51.254.16.113", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1748062580, "child_nodes" : [], "startdate" : "25 May 24 10:26", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 45000, "max_email_per_hour" : "25" }, { "theme" : "jupiter", "uid" : "1493", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "royaldiagnosticc_Unlimited", "user" : "regional", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "regionaldiag.in", "diskused" : "197M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "*unknown*", "maxlst" : "unlimited", "unix_startdate" : 1726636873, "startdate" : "24 Sep 18 10:51", "child_nodes" : [], "suspendtime" : 0, "owner" : "royaldiagnosticc", "max_email_per_hour" : "*unknown*", "inodesused" : 24471, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "max_email_per_hour" : "25", "inodesused" : 1217, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1568093716, "child_nodes" : [], "startdate" : "19 Sep 10 11:05", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "ip" : "51.91.152.238", "domain" : "maqsadcg.org.in", "diskused" : "26M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "plan" : "websbook_linux_500mb", "user" : "maqsadcgorg", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1207", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1 }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 1411, "max_email_per_hour" : "unlimited", "owner" : "thesunda", "suspendtime" : 0, "child_nodes" : [], "startdate" : "23 Sep 01 19:29", "unix_startdate" : 1693576750, "maxlst" : "unlimited", "partition" : "home2", "email" : "sacretcode@gmail.com", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "250M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "92M", "domain" : "bhagwatijyotish.com", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "bhagwati", "plan" : "thesunda_250 mb", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1401", "maxsql" : "unlimited", "theme" : "jupiter" }, { "domain" : "mohabbatmission.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "937M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "user" : "mohabbatmission", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2340", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "inodesused" : 44866, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "child_nodes" : [], "startdate" : "25 Feb 28 13:56", "unix_startdate" : 1740731179, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "has_backup" : 0, "disklimit" : "unlimited" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "digitalmediacraf", "plan" : "thesunda_500", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1404", "maxsql" : "unlimited", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "152M", "domain" : "digitalmediacraft.in", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "child_nodes" : [], "startdate" : "24 Jan 31 00:53", "unix_startdate" : 1706642613, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "sacretcode@gmail.com", "disklimit" : "512M", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 4647, "max_email_per_hour" : "25", "owner" : "thesunda", "suspendtime" : 0 }, { "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2336", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "mindianews", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "4054M", "suspendreason" : "not suspended", "domain" : "mindianews.in", "ip" : "51.254.16.113", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1754657655, "startdate" : "25 Aug 08 18:24", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 23446, "max_email_per_hour" : "25" }, { "suspendtime" : 0, "owner" : "websbook", "inodesused" : 2677, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "3", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "1", "has_backup" : 0, "disklimit" : "1000M", "unix_startdate" : 1521292144, "startdate" : "18 Mar 17 18:39", "child_nodes" : [], "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "aldabeatz.in", "ip" : "51.91.152.238", "diskused" : "232M", "suspendreason" : "not suspended", "maxsql" : "2", "uid" : "1092", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "plan" : "websbook_1000 MB Linux", "user" : "aldabeatz", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "plan" : "winggolearning_raj", "user" : "trishulwelfareso", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "unlimited", "uid" : "2525", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "trishulwelfaresociety.in", "ip" : "51.254.16.113", "diskused" : "991M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "unix_startdate" : 1759913446, "child_nodes" : [], "startdate" : "25 Oct 08 14:20", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 43311, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "pavanpath", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2372", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "940M", "suspendreason" : "not suspended", "domain" : "pavanpathfoundation.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1755520204, "startdate" : "25 Aug 18 18:00", "child_nodes" : [], "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 44638, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "ip" : "51.91.152.238", "domain" : "jpsmv.org.in", "suspendreason" : "not suspended", "diskused" : "71M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "jpsmvorg", "plan" : "websbook_Linux_100mb", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "uid" : "1188", "maxsql" : "1", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "max_email_per_hour" : "unlimited", "inodesused" : 1858, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "startdate" : "15 Dec 01 10:45", "child_nodes" : [], "unix_startdate" : 1448946901, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "has_backup" : 0, "disklimit" : "200M", "maxlst" : "0", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*" }, { "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "26 May 08 10:24", "child_nodes" : [], "unix_startdate" : 1778216078, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 67357, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2889", "maxsql" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "basantmemorialtr", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "836M", "ip" : "51.254.16.113", "domain" : "basantmemorialtrust.in" }, { "unix_startdate" : 1748440889, "startdate" : "25 May 28 19:31", "child_nodes" : [], "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 45237, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "virendraahelpcar", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2497", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "diskused" : "932M", "suspendreason" : "not suspended", "domain" : "virendraahelpcarefoundation.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "max_emailacct_quota" : "unlimited", "maxftp" : "10", "uid" : "2569", "maxsql" : "20", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "user" : "madameichamlefil", "plan" : "otiyahos_ECO", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "10", "maxparked" : "0", "domain" : "madameicham-lefilm.ca", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "16M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "agenceotiya@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "100000M", "startdate" : "25 Nov 19 22:19", "child_nodes" : [], "unix_startdate" : 1763570977, "suspendtime" : 0, "owner" : "otiyahos", "inodesused" : 295, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "46M", "suspendreason" : "not suspended", "domain" : "stravoneng.com", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "10", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxsql" : "1", "uid" : "2666", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "hhtechsolution_H_Adv", "user" : "stravoneng", "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 577, "max_email_per_hour" : "25", "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "1", "disklimit" : "1500M", "has_backup" : 0, "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1753802680, "child_nodes" : [], "startdate" : "25 Jul 29 20:54" }, { "suspendreason" : "not suspended", "diskused" : "98M", "domain" : "santsinghlawdegreecollege.org", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "santsing", "plan" : "websbook_Linux_100mb", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxftp" : "0", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1277", "theme" : "jupiter", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 6876, "max_email_per_hour" : "unlimited", "owner" : "websbook", "suspendtime" : 0, "child_nodes" : [], "startdate" : "14 Jun 27 20:13", "unix_startdate" : 1403880232, "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "disklimit" : "200M", "has_backup" : 0, "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited" }, { "inodesused" : 332, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "child_nodes" : [], "startdate" : "22 Sep 16 23:11", "unix_startdate" : 1663350093, "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "disklimit" : "200M", "has_backup" : 0, "domain" : "citizengirlscollegebtc.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "12M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "citizenbtc", "plan" : "websbook_Linux_100mb", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "0", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1122", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "life", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2314", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "diskused" : "903M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "life-letindividualfeelsforeveryone.in", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1718891573, "child_nodes" : [], "startdate" : "24 Jun 20 19:22", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 34722, "owner" : "winggolearning", "suspendtime" : 0 }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "abggrf", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2162", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "diskused" : "1008M", "suspendreason" : "not suspended", "domain" : "abggrf.com", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1745323671, "child_nodes" : [], "startdate" : "25 Apr 22 17:37", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 45670, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "startdate" : "26 Mar 14 16:23", "child_nodes" : [], "unix_startdate" : 1773485618, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 69382, "owner" : "winggolearning", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "chrsje", "plan" : "winggolearning_raj", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2813", "suspendreason" : "not suspended", "diskused" : "1409M", "ip" : "51.254.16.113", "domain" : "chrsje.org.in", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0 }, { "max_email_per_hour" : "25", "inodesused" : 146144, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "otiyahos", "startdate" : "23 May 27 16:44", "child_nodes" : [], "unix_startdate" : 1685186069, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "100000M", "maxlst" : "unlimited", "email" : "togolais2008@gmail.com", "partition" : "home", "outgoing_mail_hold" : 0, "ip" : "51.91.152.238", "domain" : "afriksportnews.com", "suspendreason" : "not suspended", "diskused" : "18429M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "10", "maxparked" : "0", "user" : "afriksportnews", "plan" : "otiyahos_ECO", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "maxsql" : "20", "uid" : "1012", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited" }, { "suspendreason" : "not suspended", "diskused" : "959M", "ip" : "51.254.16.113", "domain" : "yeforum.org", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "yeforum", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2512", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 37912, "owner" : "winggolearning", "suspendtime" : 0, "child_nodes" : [], "startdate" : "24 Nov 20 15:46", "unix_startdate" : 1732097778, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited" }, { "child_nodes" : [], "startdate" : "24 Dec 02 19:59", "unix_startdate" : 1733149760, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 42484, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "user" : "harekrishna", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2264", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "harekrishnafoundation.co", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1237M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1" }, { "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 10801, "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "startdate" : "20 Aug 07 15:28", "child_nodes" : [], "unix_startdate" : 1596794319, "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "306M", "ip" : "51.91.152.238", "domain" : "vidhimanthan.com", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1334", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "vidhimanthan", "plan" : "websbook_linux_500mb" }, { "ip" : "51.91.152.238", "domain" : "medtechmulticlinic.co.in", "suspendreason" : "not suspended", "diskused" : "223M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "unlimited", "maxaddons" : "0", "user" : "medtechmulticlin", "plan" : "smarttec_Buy Host 5", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1481", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "max_email_per_hour" : "25", "inodesused" : 24010, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "royaldiagnosticc", "startdate" : "23 Feb 17 20:47", "child_nodes" : [], "unix_startdate" : 1676647075, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "ASHIQULRAHMAN175@GMAIL.COM", "outgoing_mail_hold" : 0 }, { "diskused" : "1041M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "sriyatharthparmarthsevasamiti.com", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "sriyatharth", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2463", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 44617, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1731050376, "child_nodes" : [], "startdate" : "24 Nov 08 12:49", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited" }, { "user" : "jpsedorg", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1185", "maxsql" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "domain" : "jpsed.org.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "174M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "child_nodes" : [], "startdate" : "15 Dec 01 10:46", "unix_startdate" : 1448946999, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "500M", "inodesused" : 3702, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook" }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 68595, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "email" : "nadabeli85@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1775649496, "child_nodes" : [], "startdate" : "26 Apr 08 17:28", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "getembefoundation.in", "diskused" : "1279M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "2843", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "plan" : "winggolearning_raj", "user" : "getembefoundatio", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 37517, "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "24 Sep 14 15:25", "child_nodes" : [], "unix_startdate" : 1726307738, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "suspendreason" : "not suspended", "diskused" : "909M", "ip" : "51.254.16.113", "domain" : "nirbhayafoundation.org", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "foundationnir", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2252" }, { "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "441M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "ramadeviconventschool.com", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2705", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "apkquest_2gb", "user" : "ramadec2", "owner" : "apkquest", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 12565, "has_backup" : 0, "disklimit" : "2048M", "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1765624787, "child_nodes" : [], "startdate" : "25 Dec 13 16:49" }, { "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1570196721, "startdate" : "19 Oct 04 19:15", "child_nodes" : [], "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1977, "max_email_per_hour" : "25", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "uid" : "1336", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500mb", "user" : "vikalpwars", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "103M", "suspendreason" : "not suspended", "domain" : "vikalpwars.org", "ip" : "51.91.152.238" }, { "suspendtime" : 0, "owner" : "websbook", "inodesused" : 2155, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "disklimit" : "500M", "has_backup" : 0, "child_nodes" : [], "startdate" : "24 Oct 04 09:12", "unix_startdate" : 1728013375, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "irarcda.org.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "67M", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "1175", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "user" : "irarcdaorg", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "tiggc", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2787", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "942M", "suspendreason" : "not suspended", "domain" : "tiggc.com", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1771658248, "startdate" : "26 Feb 21 12:47", "child_nodes" : [], "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 42885, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "plan" : "websbook_linux_500mb", "user" : "kpmv", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxsql" : "1", "uid" : "1195", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "kppg.org.in", "diskused" : "387M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "unix_startdate" : 1362125011, "startdate" : "13 Mar 01 13:33", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "max_email_per_hour" : "25", "inodesused" : 21742, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook" }, { "owner" : "pawsnmei", "suspendtime" : 1778221817, "mailbox_format" : "maildir", "shell" : "/bin/false", "max_email_per_hour" : "unlimited", "inodesused" : 3430, "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "onedestinyahead@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 1, "maxsub" : "unlimited", "unix_startdate" : 1715242625, "child_nodes" : [], "startdate" : "24 May 09 13:47", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "128M", "suspendreason" : "Overdue on Payment", "ip" : "51.91.152.238", "domain" : "vpaenterprises.com", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1526", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 1, "plan" : "default", "user" : "vpaadmin" }, { "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "10", "legacy_backup" : 0, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "2693", "maxsql" : "2", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "lwaziacademy", "plan" : "topweblogic_Silver Package", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1071M", "ip" : "51.91.152.238", "domain" : "lwaziacademy.com", "disklimit" : "1000M", "has_backup" : 0, "maxlst" : "25", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "topweblogic@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "startdate" : "25 Dec 09 18:35", "child_nodes" : [], "unix_startdate" : 1765285521, "owner" : "topweblogic", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 24338 }, { "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "child_nodes" : [], "startdate" : "26 Jan 29 16:27", "unix_startdate" : 1769684265, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 64318, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2758", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "user" : "kanyadan", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "kanyadan.org.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1148M" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "stardiagnosticbp", "plan" : "royaldiagnosticc_Unlimited plan", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1495", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "249M", "domain" : "stardiagnostic.online", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "child_nodes" : [], "startdate" : "24 Jan 09 21:56", "unix_startdate" : 1704817562, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 9047, "max_email_per_hour" : "unlimited", "owner" : "royaldiagnosticc", "suspendtime" : 0 }, { "user" : "uallp", "plan" : "hhtechsolution_H_Basic", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2675", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "ip" : "51.91.152.238", "domain" : "uallp.in", "suspendreason" : "not suspended", "diskused" : "235M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "child_nodes" : [], "startdate" : "23 Oct 14 18:12", "unix_startdate" : 1697287375, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "disklimit" : "250M", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "max_email_per_hour" : "25", "inodesused" : 2942, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "hhtechsolution" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 38307, "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "24 Sep 16 12:07", "child_nodes" : [], "unix_startdate" : 1726468636, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "suspendreason" : "not suspended", "diskused" : "1071M", "ip" : "51.254.16.113", "domain" : "sarvjanseva.in", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "sarvjanseva", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2423" }, { "ip" : "51.91.152.238", "domain" : "shyamballoondecorations.com", "suspendreason" : "not suspended", "diskused" : "108M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "balloondecoshy", "plan" : "hhtechsolution_H_Basic", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2795", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "5", "max_email_per_hour" : "25", "inodesused" : 670, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "hhtechsolution", "child_nodes" : [], "startdate" : "26 Feb 27 15:18", "unix_startdate" : 1772185727, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "disklimit" : "250M", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 26559, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1764861668, "startdate" : "25 Dec 04 20:51", "child_nodes" : [], "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "849M", "suspendreason" : "not suspended", "domain" : "sevaeducationaltrust.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "cationaltrust", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2583", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "amenterprisesind", "plan" : "hhtechsolution_H_Basic", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "2593", "maxsql" : "1", "suspendreason" : "not suspended", "diskused" : "198M", "ip" : "51.91.152.238", "domain" : "amenterprisesind.com", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "child_nodes" : [], "startdate" : "25 Sep 16 14:33", "unix_startdate" : 1758013412, "disklimit" : "250M", "has_backup" : 0, "maxlst" : "unlimited", "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 1738, "owner" : "hhtechsolution", "suspendtime" : 0 }, { "theme" : "jupiter", "uid" : "1322", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "10", "plan" : "default", "user" : "thehauntings", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "5", "maxaddons" : "5", "ip" : "51.91.152.238", "domain" : "thehauntingsinmadhyapradesh.com", "diskused" : "730M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "unlimited", "unix_startdate" : 1607004687, "child_nodes" : [], "startdate" : "20 Dec 03 19:41", "suspendtime" : 0, "owner" : "websiteg", "max_email_per_hour" : "30", "inodesused" : 7357, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "1M", "suspendreason" : "not suspended", "domain" : "ngowebsite.online", "ip" : "51.254.16.113", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2891", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "onlinengo", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 81, "max_email_per_hour" : "25", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1778304968, "startdate" : "26 May 09 11:06", "child_nodes" : [] }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "visionbundelkhan", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "maxsql" : "1", "uid" : "1338", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "34M", "suspendreason" : "not suspended", "domain" : "visionbundelkhand.org.in", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1715271105, "child_nodes" : [], "startdate" : "24 May 09 21:41", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1324, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0 }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 43817, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "unix_startdate" : 1767190117, "startdate" : "25 Dec 31 19:38", "child_nodes" : [], "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "aasrafoundationtrust.in", "diskused" : "971M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "2728", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "plan" : "winggolearning_raj", "user" : "aasrafoundationt", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "maxlst" : "unlimited", "partition" : "home", "email" : "togolais2008@gmail.com", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "100000M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "22 Jul 25 14:38", "unix_startdate" : 1658740084, "owner" : "otiyahos", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 38165, "max_email_per_hour" : "25", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "10", "uid" : "1039", "maxsql" : "20", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "savanesinfo", "plan" : "otiyahos_ECO", "maxaddons" : "10", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "3372M", "domain" : "savanesinfo.tg", "ip" : "51.91.152.238" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "royaldiagnosticc_Unlimited plan", "user" : "newlife", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "maxsql" : "unlimited", "uid" : "1486", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "diskused" : "256M", "suspendreason" : "not suspended", "domain" : "newlife.in", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1701343147, "child_nodes" : [], "startdate" : "23 Nov 30 16:49", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 21470, "max_email_per_hour" : "*unknown*", "owner" : "royaldiagnosticc", "suspendtime" : 0 }, { "child_nodes" : [], "startdate" : "26 Mar 12 11:05", "unix_startdate" : 1773293735, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "max_email_per_hour" : "25", "inodesused" : 67219, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "user" : "saishraddhachari", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2808", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "ip" : "51.254.16.113", "domain" : "saishraddhacharitabletrust.org", "suspendreason" : "not suspended", "diskused" : "958M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "dhyanyogfoundati", "plan" : "winggolearning_raj", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2879", "suspendreason" : "not suspended", "diskused" : "915M", "ip" : "51.254.16.113", "domain" : "dhyanyogfoundation.in", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "startdate" : "26 May 02 16:22", "child_nodes" : [], "unix_startdate" : 1777719168, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 68688, "owner" : "winggolearning", "suspendtime" : 0 }, { "max_email_per_hour" : "unlimited", "inodesused" : 27089, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "royaldiagnosticc", "unix_startdate" : 1739795287, "child_nodes" : [], "startdate" : "25 Feb 17 17:58", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home2", "maxlst" : "unlimited", "ip" : "51.91.152.238", "domain" : "doctorsclinic.in", "diskused" : "1001M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "plan" : "royaldiagnosticc_Unlimited", "user" : "doctorsclinic", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1468", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1 }, { "diskused" : "942M", "suspendreason" : "not suspended", "domain" : "trivenifoundation.net.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "triveni", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "unlimited", "uid" : "2482", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 40342, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1726466473, "startdate" : "24 Sep 16 11:31", "child_nodes" : [], "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2863", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "plan" : "winggolearning_raj", "user" : "phwf", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "phwf.org.in", "diskused" : "1242M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1776945888, "child_nodes" : [], "startdate" : "26 Apr 23 17:34", "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 66406, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "unix_startdate" : 1399614536, "child_nodes" : [], "startdate" : "14 May 09 11:18", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0", "max_email_per_hour" : "25", "inodesused" : 4952, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "plan" : "websbook_linux_500mb", "user" : "rnpaniti", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1259", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "rnpandeypvtiti.org.in", "diskused" : "221M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0" }, { "domain" : "matrushreeengineering.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "937M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "matrushreeengine", "plan" : "topweblogic_Silver Package", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "2", "uid" : "2552", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "10", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "inodesused" : 33344, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "topweblogic", "child_nodes" : [], "startdate" : "24 May 08 14:42", "unix_startdate" : 1715159527, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "25", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "1000M" }, { "plan" : "websbook_Linux_100mb", "user" : "satyanarayanmaha", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "1", "uid" : "1279", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "domain" : "satyanarayanmahavidyalaya.org.in", "ip" : "51.91.152.238", "diskused" : "33M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "unix_startdate" : 1413390810, "child_nodes" : [], "startdate" : "14 Oct 15 22:03", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "has_backup" : 0, "disklimit" : "200M", "inodesused" : 1038, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 375, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0, "startdate" : "21 Jun 13 10:06", "child_nodes" : [], "unix_startdate" : 1623559004, "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "7M", "domain" : "sspamahavidyalaya.org.in", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "sspamahavidyalay", "plan" : "websbook_linux_500mb", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1315", "maxsql" : "1", "theme" : "jupiter" }, { "startdate" : "21 Oct 19 12:04", "child_nodes" : [], "unix_startdate" : 1634625247, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "250M", "inodesused" : 2572, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "hhtechsolution", "user" : "blueberryfreight", "plan" : "hhtechsolution_H_Basic", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2597", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "blueberryfreight.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "199M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0" }, { "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1549", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "1", "user" : "royalmer", "plan" : "RED13HOSTING", "outgoing_mail_suspended" : 0, "backup" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "unlimited", "maxaddons" : "4", "domain" : "royalmerchantfreight.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "4936M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "pattersonlsean@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "startdate" : "23 Nov 30 23:43", "child_nodes" : [], "unix_startdate" : 1701368034, "suspendtime" : 0, "owner" : "root", "inodesused" : 81368, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "user" : "wamtime", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2503", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "wamtimefoundation.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "885M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "startdate" : "24 Nov 04 11:25", "child_nodes" : [], "unix_startdate" : 1730699725, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 36501, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "owner" : "hhtechsolution", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 978, "max_email_per_hour" : "25", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "has_backup" : 0, "disklimit" : "250M", "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "23 Aug 21 07:42", "child_nodes" : [], "unix_startdate" : 1692583977, "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "63M", "domain" : "roshandivyadasanastrologer.com", "ip" : "51.91.152.238", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "2646", "maxsql" : "1", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "roshandivyadasan", "plan" : "hhtechsolution_H_Basic" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 623, "owner" : "hhtechsolution", "suspendtime" : 0, "child_nodes" : [], "startdate" : "26 Jan 17 14:06", "unix_startdate" : 1768638970, "has_backup" : 0, "disklimit" : "1500M", "maxlst" : "1", "partition" : "home2", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "suspendreason" : "not suspended", "diskused" : "6M", "ip" : "51.91.152.238", "domain" : "koreetelecom.com", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "koreetelecom", "plan" : "hhtechsolution_H_Adv", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "10", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "2745" }, { "suspendreason" : "not suspended", "diskused" : "12194M", "ip" : "51.254.16.113", "domain" : "bkbsewatrust.in", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "bkbsewatrust", "plan" : "winggolearning_raj", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2207", "maxsql" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 66416, "owner" : "winggolearning", "suspendtime" : 0, "child_nodes" : [], "startdate" : "25 Jul 14 11:47", "unix_startdate" : 1752473834, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited" }, { "inodesused" : 34641, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1728037044, "startdate" : "24 Oct 04 15:47", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "domain" : "sovatrust.in", "ip" : "51.254.16.113", "diskused" : "956M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "plan" : "winggolearning_raj", "user" : "sovatrust", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "2462", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [] }, { "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1557, "max_email_per_hour" : "25", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1601283625, "child_nodes" : [], "startdate" : "20 Sep 28 14:30", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "81M", "suspendreason" : "not suspended", "domain" : "samajdharmevamdarshan.org.in", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [], "uid" : "1273", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "samajdharmevamda" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "ekpehalngo", "plan" : "winggolearning_raj", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2244", "maxsql" : "unlimited", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "928M", "domain" : "ekpehalngo.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "child_nodes" : [], "startdate" : "25 Jul 30 13:52", "unix_startdate" : 1753863729, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 43365, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "maxsql" : "1", "uid" : "1121", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "citizen", "plan" : "websbook_Linux_100mb", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "20M", "ip" : "51.91.152.238", "domain" : "citizengirlscollege.org", "disklimit" : "200M", "has_backup" : 0, "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "startdate" : "13 Mar 02 20:19", "child_nodes" : [], "unix_startdate" : 1362235740, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 627 }, { "unix_startdate" : 1756708386, "startdate" : "25 Sep 01 12:03", "child_nodes" : [], "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 42706, "owner" : "winggolearning", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "puranjayfoundati", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2385", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "diskused" : "914M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "puranjayfoundation.in", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 327, "disklimit" : "500M", "has_backup" : 0, "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "unix_startdate" : 1703704312, "child_nodes" : [], "startdate" : "23 Dec 28 00:41", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "9M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "rbsvidhimahavidyalaya.org", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "uid" : "1254", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "rbsvidhimahavidy" }, { "maxpop" : "0", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1434", "maxsql" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "starsfactory", "plan" : "thesunda_50mb", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "118M", "domain" : "starsfactory.in", "ip" : "51.91.152.238", "maxlst" : "unlimited", "email" : "sacretcode@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "50M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "20 Sep 07 20:35", "unix_startdate" : 1599491141, "owner" : "thesunda", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 9, "max_email_per_hour" : "unlimited" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 69669, "owner" : "winggolearning", "suspendtime" : 0, "startdate" : "26 Apr 03 16:19", "child_nodes" : [], "unix_startdate" : 1775213369, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "suspendreason" : "not suspended", "diskused" : "1163M", "ip" : "51.254.16.113", "domain" : "sarvicecharitabletrust.in", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "sarvicecharitabl", "plan" : "winggolearning_raj", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2835", "maxsql" : "unlimited" }, { "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 867, "disklimit" : "250M", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "unix_startdate" : 1755580239, "child_nodes" : [], "startdate" : "25 Aug 19 10:40", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "28M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "itgeneticstechsol.in", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2625", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "hhtechsolution_H_Basic", "user" : "itgeneticstechso" }, { "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2789", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "padmashaliunnati", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "915M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "padmashaliunnatisanstha.com", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1771835410, "startdate" : "26 Feb 23 14:00", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 68822 }, { "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2215", "maxsql" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "chandramangal", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "929M", "ip" : "51.254.16.113", "domain" : "chandramangaleducationwelfaresociety.in", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "25 May 15 10:54", "unix_startdate" : 1747286688, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 44355 }, { "diskused" : "930M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "panjatanmemorialfoundation.in", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "panjatanmemorial", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2368", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 45093, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1751619212, "child_nodes" : [], "startdate" : "25 Jul 04 14:23", "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited" }, { "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "30", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "2627", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "jayanjayaassocia", "plan" : "hhtechsolution_H_Basic", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "38M", "domain" : "jayanjayaassociates.com", "ip" : "51.91.152.238", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "250M", "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "22 Mar 14 17:47", "unix_startdate" : 1647260247, "owner" : "hhtechsolution", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 959, "max_email_per_hour" : "25" }, { "plan" : "websbook_linux_500mb", "user" : "jpslawcollegeorg", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "1187", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "domain" : "jpslawcollege.org.in", "ip" : "51.91.152.238", "diskused" : "313M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "unix_startdate" : 1587277619, "child_nodes" : [], "startdate" : "20 Apr 19 11:56", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "inodesused" : 6644, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook" }, { "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "wecareforallfoundation.org", "suspendreason" : "not suspended", "diskused" : "1009M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2505", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "user" : "wecareforall", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 38349, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "nadabeli85@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "startdate" : "24 Oct 12 19:10", "child_nodes" : [], "unix_startdate" : 1728740404 }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 7079, "owner" : "websbook", "suspendtime" : 0, "startdate" : "19 Oct 23 09:39", "child_nodes" : [], "unix_startdate" : 1571803779, "has_backup" : 0, "disklimit" : "2000M", "maxlst" : "10", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "10", "suspendreason" : "not suspended", "diskused" : "229M", "ip" : "51.91.152.238", "domain" : "cabsafari.in", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "cabsafari", "plan" : "websbook_linux_2000mb", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "10", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "2", "uid" : "1118" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 66710, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "child_nodes" : [], "startdate" : "26 Mar 19 16:05", "unix_startdate" : 1773916516, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "1218M", "domain" : "shrikrishnaheartcare.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "aheartshrikris", "plan" : "winggolearning_raj", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2821", "theme" : "jupiter" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "sdssansthanorg", "plan" : "websbook_linux_500mb", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1282", "maxsql" : "1", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "82M", "domain" : "sdssansthan.org.in", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "startdate" : "22 Aug 06 21:34", "child_nodes" : [], "unix_startdate" : 1659801843, "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 1493, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0 }, { "suspendtime" : 0, "owner" : "root", "max_email_per_hour" : "unlimited", "inodesused" : 10733, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "10000M", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "email" : "vertrieb@homespiegel.de", "outgoing_mail_hold" : 0, "child_nodes" : [], "startdate" : "23 Dec 08 10:14", "unix_startdate" : 1702010650, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "camiuye.de", "suspendreason" : "not suspended", "diskused" : "3610M", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1516", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "user" : "homespie", "plan" : "Red91Solid", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "plan" : "thesunda_cine1024", "user" : "moderato", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxsql" : "5", "uid" : "1421", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "3", "ip" : "51.91.152.238", "domain" : "moderato.in", "diskused" : "607M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "unix_startdate" : 1679137762, "child_nodes" : [], "startdate" : "23 Mar 18 16:39", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "1024M", "email" : "sacretcode@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "0", "max_email_per_hour" : "25", "inodesused" : 6143, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "thesunda" }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "welltest.in", "ip" : "51.91.152.238", "diskused" : "99M", "suspendreason" : "not suspended", "maxsql" : "unlimited", "uid" : "1502", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "plan" : "royaldiagnosticc_Unlimited", "user" : "welltest", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "royaldiagnosticc", "inodesused" : 10658, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1726329240, "child_nodes" : [], "startdate" : "24 Sep 14 21:24" }, { "plan" : "hhtechsolution_H_Basic", "user" : "arbindaahaar", "outgoing_mail_suspended" : 0, "backup" : 1, "maxsql" : "1", "uid" : "2595", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "arbindaahaar.com", "ip" : "51.91.152.238", "diskused" : "226M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "unix_startdate" : 1723212046, "child_nodes" : [], "startdate" : "24 Aug 09 19:30", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "250M", "inodesused" : 1271, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "hhtechsolution" }, { "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2296", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "winggolearning_raj", "user" : "jbmngo", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "jbmngo.in", "diskused" : "959M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1734943073, "child_nodes" : [], "startdate" : "24 Dec 23 14:07", "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 43488, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "apkquest_512mb", "user" : "ramadevibic", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "uid" : "1373", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "323M", "suspendreason" : "not suspended", "domain" : "ramadevibic.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1727928719, "startdate" : "24 Oct 03 09:41", "child_nodes" : [], "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "512M", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 3747, "max_email_per_hour" : "25", "owner" : "apkquest", "suspendtime" : 0 }, { "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1752910774, "child_nodes" : [], "startdate" : "25 Jul 19 13:09", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 44772, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2363", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "nscsvs", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "917M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "nscsvs.com" }, { "inodesused" : 120832, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "root", "unix_startdate" : 1672338568, "startdate" : "22 Dec 29 23:59", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "email" : "webfoal@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "10000M", "domain" : "housingtiger.com", "ip" : "51.91.152.238", "diskused" : "5476M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "plan" : "Red91Solid", "user" : "housingt", "outgoing_mail_suspended" : 0, "backup" : 1, "maxsql" : "unlimited", "uid" : "1538", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited" }, { "owner" : "root", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 4375, "max_email_per_hour" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "vertrieb@homespiegel.de", "partition" : "home2", "has_backup" : 0, "disklimit" : "10000M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Oct 17 20:11", "unix_startdate" : 1729176067, "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1776M", "domain" : "ak0.net", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1515", "maxsql" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "aknet", "plan" : "Red91Solid" }, { "unix_startdate" : 1724501855, "child_nodes" : [], "startdate" : "24 Aug 24 17:47", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 40103, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "ssssfoundation", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "unlimited", "uid" : "2467", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "906M", "suspendreason" : "not suspended", "domain" : "ssssfoundation.com", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "inodesused" : 689, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "child_nodes" : [], "startdate" : "15 Feb 15 14:38", "unix_startdate" : 1423991335, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "500M", "domain" : "mahadeviyapvtiti.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "17M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "mahadeviyapvtiti", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1204", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20" }, { "max_email_per_hour" : "25", "inodesused" : 43036, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1755609092, "startdate" : "25 Aug 19 18:41", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "ip" : "51.254.16.113", "domain" : "vombharat.org", "diskused" : "932M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "plan" : "winggolearning_raj", "user" : "vombharat", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "2501", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited" }, { "plan" : "hhtechsolution_H_Adv", "user" : "houseplandesign", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxsql" : "1", "uid" : "2618", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "10", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "houseplandesign.in", "diskused" : "729M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "unix_startdate" : 1720795970, "startdate" : "24 Jul 12 20:22", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "has_backup" : 0, "disklimit" : "1500M", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "maxlst" : "1", "max_email_per_hour" : "25", "inodesused" : 25496, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "hhtechsolution" }, { "owner" : "root", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "50", "inodesused" : 67552, "disklimit" : "unlimited", "has_backup" : 0, "email" : "chennaiwebstore@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1589362918, "startdate" : "20 May 13 15:11", "child_nodes" : [], "maxparked" : "unlimited", "maxaddons" : "unlimited", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "3282M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "live.chennaiwebstores.com", "max_defer_fail_percentage" : "100", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1077", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "RED33RESELLER", "user" : "livechen" }, { "ip" : "51.254.16.113", "domain" : "mahilasashaktikaranfoundation.in", "diskused" : "1174M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "plan" : "winggolearning_raj", "user" : "mahilasashakti", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "2326", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "max_email_per_hour" : "25", "inodesused" : 50403, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1734706226, "startdate" : "24 Dec 20 20:20", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited" }, { "diskused" : "994M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "bbct.in", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "bbct", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2881", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 69857, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1777875946, "child_nodes" : [], "startdate" : "26 May 04 11:55", "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 42882, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1767698992, "startdate" : "26 Jan 06 16:59", "child_nodes" : [], "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "diskused" : "905M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "shreeganeshclishtkarmanafoundation.org", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "shreeganeshclish", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2733", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "bslsevasamiti", "plan" : "winggolearning_raj", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2847", "suspendreason" : "not suspended", "diskused" : "1317M", "ip" : "51.254.16.113", "domain" : "bslsevasamiti.in", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "child_nodes" : [], "startdate" : "26 Apr 09 14:57", "unix_startdate" : 1775726832, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 67935, "owner" : "winggolearning", "suspendtime" : 0 }, { "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2286", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "winggolearning_raj", "user" : "indiavcpcehb", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "indiavcpcehb.in", "diskused" : "929M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1737178834, "child_nodes" : [], "startdate" : "25 Jan 18 11:10", "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 39628, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "unix_startdate" : 1777646705, "startdate" : "26 May 01 20:15", "child_nodes" : [], "disklimit" : "unlimited", "has_backup" : 0, "email" : "agenceotiya@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/usr/local/cpanel/bin/noshell", "max_email_per_hour" : "25", "inodesused" : 4232, "owner" : "otiyahos", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "otiyahos_Pack-Webmaster", "user" : "akkomah", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2876", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "diskused" : "5448M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "akkomah.com", "maxparked" : "unlimited", "maxaddons" : "unlimited", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 148055, "max_email_per_hour" : "25", "owner" : "otiyahos", "suspendtime" : 0, "child_nodes" : [], "startdate" : "26 Jan 07 13:32", "unix_startdate" : 1767772946, "maxlst" : "unlimited", "email" : "agenceotiya@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "100000M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "31623M", "domain" : "radiooreole.tg", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "10", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "radiooreole", "plan" : "otiyahos_ECO", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "uid" : "2735", "maxsql" : "20", "theme" : "jupiter" }, { "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1473", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "royaldiagnosticc_Unlimited plan", "user" : "idealtihowly", "maxparked" : "1", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "1410M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "idealtihowly.in", "disklimit" : "unlimited", "has_backup" : 0, "email" : "*unknown*", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1725041802, "startdate" : "24 Aug 30 23:46", "child_nodes" : [], "owner" : "royaldiagnosticc", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 30364 }, { "domain" : "apepcri.in", "ip" : "51.254.16.113", "diskused" : "930M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "plan" : "winggolearning_raj", "user" : "apepcri", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "2181", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "inodesused" : 44961, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1753536117, "startdate" : "25 Jul 26 18:51", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited" }, { "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "890M", "domain" : "janlakshyasocialfoundation.com", "ip" : "51.254.16.113", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2526", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "janlakshyasocial", "plan" : "winggolearning_raj", "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 42665, "max_email_per_hour" : "25", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "25 Oct 09 19:07", "unix_startdate" : 1760017020 }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_1000 MB Linux", "user" : "mbldegre", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxsql" : "2", "uid" : "1212", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "diskused" : "285M", "suspendreason" : "not suspended", "domain" : "mbldegreecollege.com", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1362235265, "child_nodes" : [], "startdate" : "13 Mar 02 20:11", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "1", "has_backup" : 0, "disklimit" : "1000M", "maxsub" : "3", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1828, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0 }, { "ip" : "51.91.152.238", "domain" : "rudrajyotitraders.online", "diskused" : "454M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "plan" : "websbook_1000 MB Linux", "user" : "rudrajyotitrader", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1268", "maxsql" : "2", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "max_email_per_hour" : "25", "inodesused" : 17677, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1622871152, "child_nodes" : [], "startdate" : "21 Jun 05 11:02", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "3", "disklimit" : "1000M", "has_backup" : 0, "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "1" }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 67335, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1770969251, "child_nodes" : [], "startdate" : "26 Feb 13 13:24", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "geetanjalifoundation.in", "diskused" : "1216M", "suspendreason" : "not suspended", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2781", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "plan" : "winggolearning_raj", "user" : "geetanjalifounda", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "hhtechsolution_H_Basic", "user" : "newchikkamagalor", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2638", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "diskused" : "43M", "suspendreason" : "not suspended", "domain" : "newchikkamagalorecoffee.com", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1640147501, "child_nodes" : [], "startdate" : "21 Dec 22 10:01", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "250M", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 2990, "max_email_per_hour" : "25", "owner" : "hhtechsolution", "suspendtime" : 0 }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "lalitakohli.com", "ip" : "51.91.152.238", "diskused" : "3322M", "suspendreason" : "not suspended", "maxsql" : "unlimited", "uid" : "1417", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "default", "user" : "lalitakohli", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "thesunda", "inodesused" : 91398, "max_email_per_hour" : "50", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "sacretcode@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "unix_startdate" : 1606016339, "startdate" : "20 Nov 22 09:08", "child_nodes" : [] }, { "unix_startdate" : 1735224478, "startdate" : "24 Dec 26 20:17", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 35387, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "plan" : "winggolearning_raj", "user" : "rajashyamala", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "2388", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "ip" : "51.254.16.113", "domain" : "rajashyamalafoundation.in", "diskused" : "876M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1" }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "paramloksevafoun", "plan" : "winggolearning_raj", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2700", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "881M", "domain" : "paramloksevafoundation.in", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "child_nodes" : [], "startdate" : "25 Dec 13 11:22", "unix_startdate" : 1765605138, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 61406, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0 }, { "unix_startdate" : 1767084111, "child_nodes" : [], "startdate" : "25 Dec 30 14:11", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 64926, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "axinobuildmudraf", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "unlimited", "uid" : "2724", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "1179M", "suspendreason" : "not suspended", "domain" : "axinobuildmudrafoundation.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "startdate" : "24 Mar 08 11:12", "child_nodes" : [], "unix_startdate" : 1709876543, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "*unknown*", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 15001, "owner" : "royaldiagnosticc", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "maia", "plan" : "royaldiagnosticc_Unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1480", "maxsql" : "unlimited", "suspendreason" : "not suspended", "diskused" : "123M", "ip" : "51.91.152.238", "domain" : "maia.in", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0 }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 45193, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "startdate" : "25 Nov 04 19:19", "child_nodes" : [], "unix_startdate" : 1762264177, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "ecoglowfoundation.in", "suspendreason" : "not suspended", "diskused" : "1026M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2554", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "user" : "ecoglowfoundatio", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "suspendreason" : "not suspended", "diskused" : "1881M", "domain" : "ledito.tg", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "10", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "ledito", "plan" : "otiyahos_ECO", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxftp" : "10", "max_emailacct_quota" : "unlimited", "uid" : "2822", "maxsql" : "20", "theme" : "jupiter", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 22437, "max_email_per_hour" : "25", "owner" : "otiyahos", "suspendtime" : 0, "startdate" : "26 Mar 19 22:56", "child_nodes" : [], "unix_startdate" : 1773941179, "maxlst" : "unlimited", "email" : "agenceotiya@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "100000M", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited" }, { "ip" : "51.254.16.113", "domain" : "shrikrishnajankalyantrust.in", "suspendreason" : "not suspended", "diskused" : "1072M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "user" : "jankalyan", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2294", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "max_email_per_hour" : "25", "inodesused" : 39569, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "child_nodes" : [], "startdate" : "24 Nov 07 16:35", "unix_startdate" : 1730977503, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0 }, { "inodesused" : 67391, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "startdate" : "26 Jan 20 20:18", "child_nodes" : [], "unix_startdate" : 1768920498, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited", "domain" : "niswa.org.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "834M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "user" : "niswa", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2751", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [] }, { "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1750257751, "child_nodes" : [], "startdate" : "25 Jun 18 20:12", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 55388, "max_email_per_hour" : "25", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2364", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "oneplant", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "1411M", "suspendreason" : "not suspended", "domain" : "oneplantagarwood.com", "ip" : "51.254.16.113" }, { "owner" : "topweblogic", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "*unknown*", "inodesused" : 17862, "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "topweblogic@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1503999798, "child_nodes" : [], "startdate" : "17 Aug 29 15:13", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "2437M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "bodelicollege.in", "max_defer_fail_percentage" : "*unknown*", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2114", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "default", "user" : "bodelicollege" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 490, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0, "child_nodes" : [], "startdate" : "18 Feb 23 14:14", "unix_startdate" : 1519375484, "maxlst" : "0", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "32M", "domain" : "skmvhedu.org", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "skmvhedu", "plan" : "websbook_linux_500mb", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1297", "theme" : "jupiter" }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "mssewatrust.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "967M", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2342", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "mssewatrust", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 45544, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "child_nodes" : [], "startdate" : "25 Jun 27 10:21", "unix_startdate" : 1750999898 }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "20", "has_backup" : 0, "disklimit" : "10000M", "maxlst" : "20", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "aashika6576@gmail.com", "startdate" : "19 Jul 01 21:28", "child_nodes" : [], "unix_startdate" : 1561996731, "suspendtime" : 0, "owner" : "websiteg", "max_email_per_hour" : "unlimited", "inodesused" : 19291, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "maxftp" : "20", "max_emailacct_quota" : "unlimited", "maxsql" : "20", "uid" : "1078", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "20", "legacy_backup" : 1, "user" : "annai", "plan" : "websiteg_annaig", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "20", "maxaddons" : "20", "ip" : "51.91.152.238", "domain" : "annaigroup.org", "suspendreason" : "not suspended", "diskused" : "1581M" }, { "maxaddons" : "0", "maxparked" : "unlimited", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "4M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "itqan.ma", "ipv6" : [], "max_defer_fail_percentage" : "100", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1547", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "RED31RESELLER", "user" : "itqanma", "owner" : "root", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 135, "disklimit" : "unlimited", "has_backup" : 0, "email" : "mr.bekouri@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1702387484, "startdate" : "23 Dec 12 18:54", "child_nodes" : [] }, { "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1914, "max_email_per_hour" : "25", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1362212324, "startdate" : "13 Mar 02 13:48", "child_nodes" : [], "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "76M", "suspendreason" : "not suspended", "domain" : "urmiladevidegreecollege.org.in", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxsql" : "1", "uid" : "1325", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "urmilade" }, { "child_nodes" : [], "startdate" : "24 May 09 13:22", "unix_startdate" : 1715241171, "maxsub" : "unlimited", "suspended" : 1, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "onedestinyahead@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 16344, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 1767126035, "owner" : "pawsnmei", "user" : "onedestinyahead", "plan" : "default", "backup" : 1, "outgoing_mail_suspended" : 1, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1521", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "domain" : "gormart.in", "ip" : "51.91.152.238", "suspendreason" : "Unknown", "diskused" : "1122M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0" }, { "startdate" : "23 Dec 15 10:08", "child_nodes" : [], "unix_startdate" : 1702615082, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "skystechnologyllp@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "max_email_per_hour" : "unlimited", "inodesused" : 27744, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "skystechnology", "user" : "mommastouch", "plan" : "skystechnology_skystech_premium_ornests", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1397", "maxsql" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "mommastouch.in", "suspendreason" : "not suspended", "diskused" : "4585M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "5", "maxparked" : "5" }, { "inodesused" : 848, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "hhtechsolution", "unix_startdate" : 1686936840, "child_nodes" : [], "startdate" : "23 Jun 16 23:04", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "250M", "domain" : "sbrresidency.com", "ip" : "51.91.152.238", "diskused" : "82M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "plan" : "hhtechsolution_H_Basic", "user" : "sbrresidency", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "1", "uid" : "2658", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "30", "ipv6" : [] }, { "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 840, "has_backup" : 0, "disklimit" : "200M", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "unix_startdate" : 1379610238, "startdate" : "13 Sep 19 22:33", "child_nodes" : [], "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "20M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "asmemorialdegreecollege.org", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxsql" : "1", "uid" : "1097", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_Linux_100mb", "user" : "asmemor" }, { "suspendtime" : 0, "owner" : "topweblogic", "max_email_per_hour" : "25", "inodesused" : 33745, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "disklimit" : "1000M", "has_backup" : 0, "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "25", "unix_startdate" : 1773748104, "child_nodes" : [], "startdate" : "26 Mar 17 17:18", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "estellar.co.za", "diskused" : "602M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "2817", "maxsql" : "2", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "10", "plan" : "topweblogic_Silver Package", "user" : "estellar", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "startdate" : "26 Feb 11 17:03", "child_nodes" : [], "unix_startdate" : 1770809595, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 68361, "owner" : "winggolearning", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "bharathiyabuddha", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2776", "maxsql" : "unlimited", "suspendreason" : "not suspended", "diskused" : "1332M", "ip" : "51.254.16.113", "domain" : "bharathiyabuddhasanghfoundation.com", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0 }, { "maxsql" : "1", "uid" : "1216", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "plan" : "websbook_linux_500mb", "user" : "mlndegreecollege", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "domain" : "mlnpgcollege.org.in", "ip" : "51.91.152.238", "diskused" : "151M", "suspendreason" : "not suspended", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "unix_startdate" : 1659722821, "startdate" : "22 Aug 05 23:37", "child_nodes" : [], "suspendtime" : 0, "owner" : "websbook", "inodesused" : 1256, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "suspendreason" : "not suspended", "diskused" : "454M", "ip" : "51.91.152.238", "domain" : "sajivdairy.com", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "sajivdairy", "plan" : "topweblogic_Gold Package", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "10", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "5", "uid" : "2138", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 2971, "owner" : "topweblogic", "suspendtime" : 0, "startdate" : "20 Mar 30 14:58", "child_nodes" : [], "unix_startdate" : 1585560517, "disklimit" : "2000M", "has_backup" : 0, "maxlst" : "25", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1" }, { "maxlst" : "1", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "has_backup" : 0, "disklimit" : "1000M", "maxsub" : "3", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "19 Apr 29 13:31", "child_nodes" : [], "unix_startdate" : 1556524879, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 10952, "max_email_per_hour" : "25", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "2", "uid" : "1091", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "akhandbooks", "plan" : "websbook_1000 MB Linux", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "604M", "domain" : "akhandbooks.com", "ip" : "51.91.152.238" }, { "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1566624060, "startdate" : "19 Aug 24 10:51", "child_nodes" : [], "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 6, "max_email_per_hour" : "25", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "uid" : "1086", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "achintyabooks", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "711M", "suspendreason" : "not suspended", "domain" : "achintyabooks.com", "ip" : "51.91.152.238" }, { "ip" : "51.91.152.238", "domain" : "myecoworks.com", "suspendreason" : "not suspended", "diskused" : "54M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "myecoworks", "plan" : "hhtechsolution_H_Basic", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "2691", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "5", "max_email_per_hour" : "25", "inodesused" : 522, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "hhtechsolution", "child_nodes" : [], "startdate" : "25 Dec 09 08:02", "unix_startdate" : 1765247520, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "has_backup" : 0, "disklimit" : "250M", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2" }, { "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "afsaldigimarketing@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "23 Sep 22 21:20", "child_nodes" : [], "unix_startdate" : 1695397818, "owner" : "root", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 1590, "ipv6" : [], "max_defer_fail_percentage" : "100", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1442", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "linqindo", "plan" : "RED31RESELLER", "maxparked" : "unlimited", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "272M", "ip" : "51.91.152.238", "domain" : "linqindots.com" }, { "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "1", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "disklimit" : "1500M", "has_backup" : 0, "child_nodes" : [], "startdate" : "23 Oct 21 13:52", "unix_startdate" : 1697876539, "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 1905, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2615", "theme" : "jupiter", "maxpop" : "10", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "user" : "himuzic", "plan" : "hhtechsolution_H_Adv", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "himuzic.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "74M" }, { "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "speechtotext.in", "suspendreason" : "not suspended", "diskused" : "2266M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2772", "maxsql" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "user" : "speechtotext", "plan" : "undefined", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "apkquest", "max_email_per_hour" : "25", "inodesused" : 34482, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "3024M", "maxlst" : "unlimited", "partition" : "home2", "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "startdate" : "26 Feb 08 20:51", "child_nodes" : [], "unix_startdate" : 1770564107 }, { "user" : "csapiti", "plan" : "websbook_Linux_100mb", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "uid" : "1132", "maxsql" : "1", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "5", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "csapiti.com", "suspendreason" : "not suspended", "diskused" : "8M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "startdate" : "15 Jul 19 18:35", "child_nodes" : [], "unix_startdate" : 1437311111, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "has_backup" : 0, "disklimit" : "200M", "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "max_email_per_hour" : "unlimited", "inodesused" : 567, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook" }, { "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 67170, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "child_nodes" : [], "startdate" : "26 Mar 09 18:59", "unix_startdate" : 1773062964, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "aarhantyafoundation.org", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1368M", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2805", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "aarhantyafoundat", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 43928, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "25 Sep 12 11:45", "child_nodes" : [], "unix_startdate" : 1757657736, "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1115M", "ip" : "51.254.16.113", "domain" : "hlcfoundation.in", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2273", "maxsql" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "hlcfoundation", "plan" : "winggolearning_raj" }, { "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 677, "max_email_per_hour" : "25", "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "25 Feb 13 11:52", "child_nodes" : [], "unix_startdate" : 1739427723, "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "19M", "domain" : "rtcprojects.com", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1267", "maxsql" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "rtcprojects", "plan" : "websbook_linux_500mb" }, { "unix_startdate" : 1766396612, "child_nodes" : [], "startdate" : "25 Dec 22 15:13", "has_backup" : 0, "disklimit" : "512M", "email" : "shiv2144@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 12996, "owner" : "apkquest", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "apkquest_512mb", "user" : "exporterguptatra", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2713", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "diskused" : "233M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "exporterguptatraders.com", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "ip" : "51.91.152.238", "domain" : "smsdudhi.org", "diskused" : "384M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "plan" : "apkquest_512mb", "user" : "smsdudhi", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "uid" : "1380", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "max_email_per_hour" : "25", "inodesused" : 4981, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "apkquest", "unix_startdate" : 1727050862, "startdate" : "24 Sep 23 05:51", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "512M", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "shiv2144@gmail.com", "maxlst" : "unlimited" }, { "unix_startdate" : 1676439458, "child_nodes" : [], "startdate" : "23 Feb 15 11:07", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "inodesused" : 2436, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "plan" : "websbook_linux_500mb", "user" : "saipublicschool", "backup" : 1, "outgoing_mail_suspended" : 0, "maxsql" : "1", "uid" : "1272", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "domain" : "saikripapublicschool.org.in", "ip" : "51.91.152.238", "diskused" : "74M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0" }, { "unix_startdate" : 1777901276, "child_nodes" : [], "startdate" : "26 May 04 18:57", "has_backup" : 0, "disklimit" : "100000M", "email" : "agenceotiya@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/usr/local/cpanel/bin/noshell", "max_email_per_hour" : "25", "inodesused" : 169, "owner" : "otiyahos", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "otiyahos_ECO", "user" : "societecivilemed", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "maxsql" : "20", "uid" : "2885", "max_emailacct_quota" : "unlimited", "maxftp" : "10", "diskused" : "2M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "societecivilemedias.com", "maxparked" : "0", "maxaddons" : "10", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "unix_startdate" : 1761743698, "child_nodes" : [], "startdate" : "25 Oct 29 18:44", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "25", "disklimit" : "2000M", "has_backup" : 0, "inodesused" : 27913, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "topweblogic", "plan" : "topweblogic_Gold Package", "user" : "adeeshankr", "outgoing_mail_suspended" : 0, "backup" : 1, "maxsql" : "5", "uid" : "2549", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "10", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "domain" : "adeeshankracharyamandal.in", "ip" : "51.91.152.238", "diskused" : "928M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0" }, { "suspendreason" : "not suspended", "diskused" : "887M", "domain" : "bmfoundations.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "bmfoundations", "plan" : "winggolearning_raj", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2531", "maxsql" : "unlimited", "theme" : "jupiter", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 42193, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "child_nodes" : [], "startdate" : "25 Oct 14 18:34", "unix_startdate" : 1760447088, "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited" }, { "suspendreason" : "not suspended", "diskused" : "111M", "ip" : "51.91.152.238", "domain" : "bramhadevmahavidyalaya.org", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "bramhade", "plan" : "websbook_linux_500mb", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1114", "maxsql" : "1", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 773, "owner" : "websbook", "suspendtime" : 0, "startdate" : "22 Sep 16 23:26", "child_nodes" : [], "unix_startdate" : 1663350981, "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0" }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 42926, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "unix_startdate" : 1756282109, "startdate" : "25 Aug 27 13:38", "child_nodes" : [], "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "uttarpradeshmuktimorcha.in", "diskused" : "909M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "2490", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "winggolearning_raj", "user" : "uttarpradeshmukt", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "unix_startdate" : 1727929481, "startdate" : "24 Oct 03 09:54", "child_nodes" : [], "has_backup" : 0, "disklimit" : "250M", "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "partition" : "home2", "maxlst" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "10", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "50", "inodesused" : 9, "owner" : "apkquest", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "apkquest_250mb", "user" : "smenterprisess", "max_defer_fail_percentage" : "10", "ipv6" : [], "maxpop" : "15", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1379", "maxsql" : "10", "maxftp" : "5", "max_emailacct_quota" : "unlimited", "diskused" : "515M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "smenterprisess.com", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0 }, { "max_email_per_hour" : "unlimited", "inodesused" : 18961, "mailbox_format" : "maildir", "shell" : "/bin/false", "suspendtime" : 1777876219, "owner" : "root", "unix_startdate" : 1720113756, "child_nodes" : [], "startdate" : "24 Jul 04 22:52", "inodeslimit" : "unlimited", "suspended" : 1, "maxsub" : "unlimited", "disklimit" : "10000M", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "ravikcpatil@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "ip" : "51.91.152.238", "domain" : "khabarabhitak.in", "diskused" : "2550M", "suspendreason" : "Overdue on Payment", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "plan" : "Red91Solid", "user" : "khabara1", "outgoing_mail_suspended" : 1, "backup" : 1, "theme" : "jupiter", "uid" : "1540", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited" }, { "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "unlimited", "inodesused" : 1461, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "disklimit" : "200M", "has_backup" : 0, "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "child_nodes" : [], "startdate" : "17 Jul 04 14:12", "unix_startdate" : 1499157753, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "mspvtiti.org", "suspendreason" : "not suspended", "diskused" : "75M", "theme" : "jupiter", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "uid" : "1220", "maxsql" : "1", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "5", "user" : "mspvtiti", "plan" : "websbook_Linux_100mb", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "child_nodes" : [], "startdate" : "22 Nov 07 23:11", "unix_startdate" : 1667842879, "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "1", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "disklimit" : "1500M", "has_backup" : 0, "inodesused" : 2263, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "hhtechsolution", "user" : "sunrisegardenpro", "plan" : "hhtechsolution_H_Adv", "backup" : 1, "outgoing_mail_suspended" : 0, "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "2668", "maxsql" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "10", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "domain" : "sunrisegardenproperties.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "280M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0" }, { "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "disklimit" : "1024M", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Sep 21 05:33", "unix_startdate" : 1726877000, "owner" : "apkquest", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 21148, "max_email_per_hour" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1356", "maxsql" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "f1web", "plan" : "apkquest_1gb", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "719M", "domain" : "f1web.in", "ip" : "51.91.152.238" }, { "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "2605", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "dreamphasetravel", "plan" : "hhtechsolution_H_Basic", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "191M", "domain" : "dreamphasetravel.com", "ip" : "51.91.152.238", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "disklimit" : "250M", "has_backup" : 0, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "24 May 24 22:45", "unix_startdate" : 1716570911, "owner" : "hhtechsolution", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 1790, "max_email_per_hour" : "25" }, { "max_email_per_hour" : "25", "inodesused" : 2040, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1671442240, "startdate" : "22 Dec 19 15:00", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "0", "ip" : "51.91.152.238", "domain" : "abhaypc.in", "diskused" : "40M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "plan" : "websbook_linux_500mb", "user" : "abhaypara", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxsql" : "1", "uid" : "1084", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1 }, { "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2694", "maxsql" : "unlimited", "outgoing_mail_suspended" : 1, "backup" : 1, "user" : "cargodeliveryswi", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "Unknown", "diskused" : "1477M", "ip" : "51.254.16.113", "domain" : "cargodeliveryswift.com", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "25 Dec 11 16:02", "unix_startdate" : 1765449175, "owner" : "winggolearning", "suspendtime" : 1774417654, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 28909 }, { "inodesused" : 38005, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1727538030, "startdate" : "24 Sep 28 21:10", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "domain" : "wejointogether.in", "ip" : "51.254.16.113", "diskused" : "1076M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "plan" : "winggolearning_raj", "user" : "wejointogether", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "2506", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [] }, { "max_defer_fail_percentage" : "100", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1345", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "Red94Solid_rdgagroc", "user" : "rdgagroc", "maxparked" : "unlimited", "maxaddons" : "4", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "6449M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "rdgagro.com", "has_backup" : 0, "disklimit" : "76800M", "email" : "rdggroupkota@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1729334322, "child_nodes" : [], "startdate" : "24 Oct 19 16:08", "owner" : "root", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 43316 }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "domain" : "amanimed.com", "ip" : "51.91.152.238", "diskused" : "6294M", "suspendreason" : "not suspended", "uid" : "2107", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "plan" : "default", "user" : "amanimed", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "topweblogic", "inodesused" : 38096, "max_email_per_hour" : "*unknown*", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "topweblogic@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "unix_startdate" : 1507982415, "child_nodes" : [], "startdate" : "17 Oct 14 17:30" }, { "suspendtime" : 0, "owner" : "apkquest", "max_email_per_hour" : "unlimited", "inodesused" : 36597, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "1024M", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1726872343, "startdate" : "24 Sep 21 04:15", "child_nodes" : [], "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "ranirevatidevisvnic.com", "diskused" : "605M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "1374", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "apkquest_1gb", "user" : "ranirevatidevisv", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "child_nodes" : [], "startdate" : "26 Mar 14 16:22", "unix_startdate" : 1773485572, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 43358, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "user" : "shineamansoci", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2812", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "domain" : "sunshineamansociety.com", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "969M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1" }, { "ip" : "51.91.152.238", "domain" : "ldrc.in", "diskused" : "304M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "1", "maxaddons" : "0", "plan" : "royaldiagnosticc_Unlimited plan", "user" : "ldrc", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1477", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "max_email_per_hour" : "unlimited", "inodesused" : 25101, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "royaldiagnosticc", "unix_startdate" : 1716028878, "child_nodes" : [], "startdate" : "24 May 18 16:11", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home2", "maxlst" : "unlimited" }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "domain" : "rashtriyasadgrihasthsantsangh.in", "ip" : "51.254.16.113", "diskused" : "944M", "suspendreason" : "not suspended", "uid" : "2711", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "plan" : "winggolearning_raj", "user" : "rashtriyasadgrih", "backup" : 1, "outgoing_mail_suspended" : 0, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 42833, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "unix_startdate" : 1766231493, "startdate" : "25 Dec 20 17:21", "child_nodes" : [] }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 177174, "owner" : "niipmcom", "suspendtime" : 0, "child_nodes" : [], "startdate" : "24 Nov 05 20:59", "unix_startdate" : 1730820575, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "suspendreason" : "not suspended", "diskused" : "2227M", "ip" : "51.91.152.238", "domain" : "educcons.com", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "educcogjns", "plan" : "default", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1073" }, { "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "10", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1098", "maxsql" : "10", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 1, "backup" : 1, "plan" : "websiteg_2Domain", "user" : "asplogistics", "maxparked" : "10", "maxaddons" : "3", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "931M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "asplogistics.in", "disklimit" : "5000M", "has_backup" : 0, "email" : "websitez.in@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "10", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "10", "unix_startdate" : 1638342992, "child_nodes" : [], "startdate" : "21 Dec 01 12:46", "owner" : "websiteg", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 2311 }, { "domain" : "fabel.in", "ip" : "51.91.152.238", "diskused" : "1946M", "suspendreason" : "Overdue on Payment", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "unlimited", "maxaddons" : "0", "plan" : "RED91SSD", "user" : "fabelin1", "backup" : 1, "outgoing_mail_suspended" : 1, "maxsql" : "unlimited", "uid" : "2695", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "inodesused" : 24707, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 1768019433, "owner" : "root", "unix_startdate" : 1765452970, "child_nodes" : [], "startdate" : "25 Dec 11 17:06", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 1, "email" : "hariharan09012001@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 30861, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1774079095, "child_nodes" : [], "startdate" : "26 Mar 21 13:14", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "3270M", "suspendreason" : "not suspended", "domain" : "educationsoftware.online", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "educationsoftwar", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2823", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter" }, { "uid" : "2645", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "30", "plan" : "hhtechsolution_H_Basic", "user" : "ropurifiercustom", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "domain" : "ropurifiercustomerservice.com", "ip" : "51.91.152.238", "diskused" : "72M", "suspendreason" : "not suspended", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "250M", "has_backup" : 0, "unix_startdate" : 1709642645, "startdate" : "24 Mar 05 18:14", "child_nodes" : [], "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 1177, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 19069, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "child_nodes" : [], "startdate" : "24 Jun 27 13:44", "unix_startdate" : 1719476050, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "suspendreason" : "not suspended", "diskused" : "628M", "domain" : "sanchemlifesciences.com", "ip" : "51.254.16.113", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "sanchemlife", "plan" : "winggolearning_raj", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2415", "maxsql" : "unlimited", "theme" : "jupiter" }, { "child_nodes" : [], "startdate" : "26 Apr 07 12:03", "unix_startdate" : 1775543633, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 73068, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "user" : "vyasmunifoundati", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2840", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "vyasmunifoundation.com", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1058M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1" }, { "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "945M", "ip" : "51.254.16.113", "domain" : "kartavyampaybackfoundation.com", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2852", "maxsql" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "kartavyampayback", "plan" : "winggolearning_raj", "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 44208, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "startdate" : "26 Apr 10 18:06", "child_nodes" : [], "unix_startdate" : 1775824585 }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 45343, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "child_nodes" : [], "startdate" : "25 Mar 22 19:02", "unix_startdate" : 1742650354, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "ip" : "51.254.16.113", "domain" : "rssfoundation.co.in", "suspendreason" : "not suspended", "diskused" : "1061M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2400", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "user" : "rssfoundation", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 68062, "max_email_per_hour" : "25", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1770724912, "startdate" : "26 Feb 10 17:31", "child_nodes" : [], "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1293M", "suspendreason" : "not suspended", "domain" : "deaddictionassociation.com", "ip" : "51.254.16.113", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2775", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "deaddictionassoc" }, { "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 67503, "max_email_per_hour" : "25", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1767678538, "startdate" : "26 Jan 06 11:18", "child_nodes" : [], "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "855M", "suspendreason" : "not suspended", "domain" : "munniwelfare.org", "ip" : "51.254.16.113", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2731", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "munniwelfare" }, { "domain" : "pandithrshastri.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "717M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "pandithr", "plan" : "default", "outgoing_mail_suspended" : 0, "backup" : 1, "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1423", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "inodesused" : 23869, "max_email_per_hour" : "50", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "thesunda", "child_nodes" : [], "startdate" : "20 Nov 24 18:00", "unix_startdate" : 1606221049, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "sacretcode@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0 }, { "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2836", "maxsql" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "earthavenue", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1306M", "ip" : "51.254.16.113", "domain" : "earthavenue.org", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "26 Apr 04 09:53", "unix_startdate" : 1775276607, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 67779 }, { "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1736320297, "startdate" : "25 Jan 08 12:41", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 45558, "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2208", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "bosebrigade", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "955M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "bosebrigade.com" }, { "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "admin@mrtechsolution.in", "disklimit" : "unlimited", "has_backup" : 0, "startdate" : "25 Dec 05 22:23", "child_nodes" : [], "unix_startdate" : 1764953633, "suspendtime" : 0, "owner" : "skystechnology", "inodesused" : 9966, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2683", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "user" : "mrtechsolution", "plan" : "default", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "mrtechsolution.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "419M" }, { "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "25 Dec 06 12:37", "child_nodes" : [], "unix_startdate" : 1765004828, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 59761, "max_email_per_hour" : "25", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2685", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "ramashraywelfare", "plan" : "winggolearning_raj", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "869M", "domain" : "ramashraywelfaretrust.in", "ip" : "51.254.16.113" }, { "user" : "maashakambharise", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2874", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "ip" : "51.254.16.113", "domain" : "maashakambharisewasamitiwelfaretrust.in", "suspendreason" : "not suspended", "diskused" : "918M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "child_nodes" : [], "startdate" : "26 May 01 16:17", "unix_startdate" : 1777632461, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "max_email_per_hour" : "25", "inodesused" : 68494, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "startdate" : "25 Aug 07 21:05", "child_nodes" : [], "unix_startdate" : 1754580959, "has_backup" : 0, "disklimit" : "2048M", "maxlst" : "unlimited", "email" : "sacretcode@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 14965, "owner" : "thesunda", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "buildtech", "plan" : "thesunda_Metalart2GB", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1981", "suspendreason" : "not suspended", "diskused" : "460M", "ip" : "51.91.152.238", "domain" : "incensebuildtech.com", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0 }, { "suspendtime" : 0, "owner" : "topweblogic", "inodesused" : 24222, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "25", "partition" : "home2", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "disklimit" : "1000M", "has_backup" : 0, "child_nodes" : [], "startdate" : "23 Sep 23 10:45", "unix_startdate" : 1695446128, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "barodasweetsnbakery.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "933M", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "2", "uid" : "2111", "theme" : "jupiter", "maxpop" : "10", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "user" : "barodasweetsnbak", "plan" : "topweblogic_Silver Package", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "domain" : "illuminatispa.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "19M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "illuminatispa", "plan" : "apkquest_250mb", "backup" : 1, "outgoing_mail_suspended" : 0, "max_emailacct_quota" : "unlimited", "maxftp" : "5", "maxsql" : "10", "uid" : "1358", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "15", "ipv6" : [], "max_defer_fail_percentage" : "10", "inodesused" : 526, "max_email_per_hour" : "50", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "apkquest", "child_nodes" : [], "startdate" : "24 Oct 08 15:52", "unix_startdate" : 1728382931, "maxsub" : "10", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "5", "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "partition" : "home2", "disklimit" : "250M", "has_backup" : 0 }, { "child_nodes" : [], "startdate" : "20 Aug 24 23:22", "unix_startdate" : 1598291541, "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 13104, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "vidhisite", "plan" : "websbook_linux_500mb", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1335", "maxsql" : "1", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "390M", "domain" : "vidhimanthan.site", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0 }, { "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "sundaridevibenipvtiti.in", "suspendreason" : "not suspended", "diskused" : "27M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "5", "maxsql" : "10", "uid" : "1386", "max_defer_fail_percentage" : "10", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "15", "user" : "sundaridevibenip", "plan" : "apkquest_250mb", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "apkquest", "max_email_per_hour" : "50", "inodesused" : 909, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "10", "disklimit" : "250M", "has_backup" : 0, "maxlst" : "5", "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "child_nodes" : [], "startdate" : "24 Oct 03 11:35", "unix_startdate" : 1727935517 }, { "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 51999, "max_email_per_hour" : "25", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1733842284, "child_nodes" : [], "startdate" : "24 Dec 10 20:21", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1251M", "suspendreason" : "not suspended", "domain" : "manihar.org", "ip" : "51.254.16.113", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "uid" : "2329", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "manihar" }, { "unix_startdate" : 1719334106, "child_nodes" : [], "startdate" : "24 Jun 25 22:18", "email" : "duttahospital1@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "10000M", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 1, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 7833, "max_email_per_hour" : "unlimited", "owner" : "root", "suspendtime" : 1750833084, "backup" : 1, "outgoing_mail_suspended" : 1, "plan" : "Red91Solid", "user" : "duttahos", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxsql" : "unlimited", "uid" : "1534", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "diskused" : "220M", "suspendreason" : "Overdue on Payment", "domain" : "duttahospital.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "domain" : "jsf.org.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "932M", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2304", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "user" : "jsf", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 44844, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "startdate" : "25 Jun 03 14:35", "child_nodes" : [], "unix_startdate" : 1748941513 }, { "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "has_backup" : 0, "disklimit" : "200M", "startdate" : "13 Mar 02 20:27", "child_nodes" : [], "unix_startdate" : 1362236220, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 737, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "uid" : "1082", "maxsql" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "user" : "abhaybal", "plan" : "websbook_Linux_100mb", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "abhaybalikamahavidyalaya.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "15M" }, { "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1751367503, "startdate" : "25 Jul 01 16:28", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 45539, "max_email_per_hour" : "25", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2291", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "jagannathsarkar", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "991M", "suspendreason" : "not suspended", "domain" : "jagannathsarkar.org", "ip" : "51.254.16.113" }, { "owner" : "root", "suspendtime" : 1765607435, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 14981, "max_email_per_hour" : "25", "outgoing_mail_hold" : 0, "email" : "amit_sharma173@yahoo.in", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "5120M", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 1, "unix_startdate" : 1763009998, "startdate" : "25 Nov 13 10:29", "child_nodes" : [], "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1082M", "suspendreason" : "Overdue on Payment", "domain" : "fastcreditdigital.in", "ip" : "51.91.152.238", "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "uid" : "2562", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 1, "plan" : "RED901RESELLER", "user" : "fastcred" }, { "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Dec 20 16:52", "unix_startdate" : 1734693779, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 36860, "max_email_per_hour" : "25", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2308", "maxsql" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "karmpratham", "plan" : "winggolearning_raj", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1093M", "domain" : "karmprathamcharitablefoundation.in", "ip" : "51.254.16.113" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "default", "user" : "buzzingscoop", "legacy_backup" : 0, "maxpop" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "uid" : "1987", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "diskused" : "1M", "suspendreason" : "not suspended", "domain" : "buzzingscoop.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "unix_startdate" : 1758008939, "child_nodes" : [], "startdate" : "25 Sep 16 13:18", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "creationsmisaki@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 98, "max_email_per_hour" : "25", "owner" : "misakic2", "suspendtime" : 0 }, { "theme" : "jupiter", "maxsql" : "1", "uid" : "1109", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "plan" : "websbook_linux_500mb", "user" : "bharathmatrimo", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "jeevanlagan.in", "diskused" : "184M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "unix_startdate" : 1620064918, "startdate" : "21 May 03 23:31", "child_nodes" : [], "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 14081, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1363", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "user" : "kpheiallahabad", "plan" : "apkquest_512mb", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "kpheiallahabad.com", "suspendreason" : "not suspended", "diskused" : "478M", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "512M", "has_backup" : 0, "maxlst" : "unlimited", "email" : "shiv2144@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "startdate" : "24 Sep 29 18:20", "child_nodes" : [], "unix_startdate" : 1727614204, "suspendtime" : 0, "owner" : "apkquest", "max_email_per_hour" : "25", "inodesused" : 15350, "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500mb", "user" : "sonanchalworldvi", "maxpop" : "5", "legacy_backup" : 0, "max_defer_fail_percentage" : "20", "ipv6" : [], "uid" : "2748", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "diskused" : "23M", "suspendreason" : "not suspended", "domain" : "sonanchalworldvisiontrust.org.in", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "unix_startdate" : 1768715625, "startdate" : "26 Jan 18 11:23", "child_nodes" : [], "partition" : "home2", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "0", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 933, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0 }, { "user" : "nbft", "plan" : "winggolearning_raj", "outgoing_mail_suspended" : 0, "backup" : 1, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2563", "maxsql" : "unlimited", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "nbft.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "976M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "startdate" : "25 Nov 13 17:44", "child_nodes" : [], "unix_startdate" : 1763036073, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "inodesused" : 43042, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "plan" : "websbook_Linux_100mb", "user" : "sbssm", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1280", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "sbssm.org", "diskused" : "25M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "unix_startdate" : 1362212809, "startdate" : "13 Mar 02 13:56", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5", "disklimit" : "200M", "has_backup" : 0, "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "0", "max_email_per_hour" : "unlimited", "inodesused" : 1090, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook" }, { "child_nodes" : [], "startdate" : "24 May 29 18:14", "unix_startdate" : 1716986682, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 48738, "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "ssvsf", "plan" : "winggolearning_raj", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2468", "suspendreason" : "not suspended", "diskused" : "1228M", "ip" : "51.254.16.113", "domain" : "ssvsf.in", "maxaddons" : "1", "maxparked" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0 }, { "startdate" : "22 Sep 27 15:29", "child_nodes" : [], "unix_startdate" : 1664272763, "maxlst" : "0", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 2460, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "jnpharmacycolleg", "plan" : "websbook_linux_500mb", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1184", "maxsql" : "1", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "65M", "domain" : "jncollegepharmacy.org.in", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0 }, { "owner" : "apkquest", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 9514, "max_email_per_hour" : "25", "email" : "shiv2144@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "disklimit" : "1024M", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1726106468, "child_nodes" : [], "startdate" : "24 Sep 12 07:31", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "201M", "suspendreason" : "not suspended", "domain" : "bricksonclicks.com", "ip" : "51.91.152.238", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxsql" : "unlimited", "uid" : "1353", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "apkquest_1gb", "user" : "bricksonclicks" }, { "inodesused" : 2312, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "hhtechsolution", "unix_startdate" : 1706282051, "child_nodes" : [], "startdate" : "24 Jan 26 20:44", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "maxlst" : "1", "has_backup" : 0, "disklimit" : "1500M", "domain" : "varidhigroupinstitutions.org", "ip" : "51.91.152.238", "diskused" : "232M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "plan" : "hhtechsolution_H_Adv", "user" : "varidhigroupinst", "outgoing_mail_suspended" : 0, "backup" : 1, "maxsql" : "1", "uid" : "2676", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "10", "ipv6" : [], "max_defer_fail_percentage" : "unlimited" }, { "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1179", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "livechen_5GB", "user" : "japchennaiwebsto", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "unlimited", "maxparked" : "unlimited", "ip" : "51.91.152.238", "domain" : "jap.chennaiwebstores.com", "diskused" : "170M", "suspendreason" : "not suspended", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "5000M", "has_backup" : 0, "email" : "chennaiwebstore@gmail.com", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1694932501, "startdate" : "23 Sep 17 12:05", "child_nodes" : [], "suspendtime" : 0, "owner" : "livechen", "max_email_per_hour" : "25", "inodesused" : 5453, "mailbox_format" : "maildir", "shell" : "/bin/bash" }, { "diskused" : "889M", "suspendreason" : "not suspended", "domain" : "zariafoundation.org", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "zariafoundation", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxsql" : "unlimited", "uid" : "2680", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 63456, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1764918498, "startdate" : "25 Dec 05 12:38", "child_nodes" : [], "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0 }, { "max_email_per_hour" : "25", "inodesused" : 44576, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning", "child_nodes" : [], "startdate" : "25 Aug 07 18:35", "unix_startdate" : 1754571911, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "ip" : "51.254.16.113", "domain" : "ittt.in", "suspendreason" : "not suspended", "diskused" : "893M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "user" : "ittt", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2290", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1 }, { "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 43999, "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1755167801, "startdate" : "25 Aug 14 16:06", "child_nodes" : [], "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "958M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "sfaassam.org", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2436", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "sfaassam" }, { "suspendreason" : "not suspended", "diskused" : "1183M", "ip" : "51.91.152.238", "domain" : "skystechnology.in", "maxaddons" : "0", "maxparked" : "unlimited", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 0, "user" : "skystechnology", "plan" : "RED31RESELLER", "ipv6" : [], "max_defer_fail_percentage" : "100", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1388", "maxsql" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 1403, "owner" : "skystechnology", "suspendtime" : 0, "startdate" : "22 Aug 31 21:22", "child_nodes" : [], "unix_startdate" : 1661961145, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "email" : "skystechnologyllp@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "smrdcoll", "plan" : "websbook_linux_500mb", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1303", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "323M", "domain" : "smrdcollege.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "child_nodes" : [], "startdate" : "13 Aug 20 10:11", "unix_startdate" : 1376973719, "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 2457, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0 }, { "suspendtime" : 0, "owner" : "niipmcom", "max_email_per_hour" : "unlimited", "inodesused" : 117808, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "50000M", "email" : "niipmpvtltd@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "unlimited", "unix_startdate" : 1730719356, "startdate" : "24 Nov 04 16:52", "child_nodes" : [], "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "niipm.com", "diskused" : "7868M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "1069", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "RED901RESELLER", "user" : "niipmcom", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1738826606, "startdate" : "25 Feb 06 12:53", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 44240, "max_email_per_hour" : "25", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "unlimited", "uid" : "2224", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "dabff", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "929M", "suspendreason" : "not suspended", "domain" : "dabff.in", "ip" : "51.254.16.113" }, { "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 5785, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "3", "disklimit" : "1000M", "has_backup" : 0, "maxlst" : "1", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "child_nodes" : [], "startdate" : "22 Jun 09 00:31", "unix_startdate" : 1654714901, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "bookshutter.com", "suspendreason" : "not suspended", "diskused" : "407M", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1113", "maxsql" : "2", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "user" : "bookshutter", "plan" : "websbook_1000 MB Linux", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "maxlst" : "1", "disklimit" : "1000M", "has_backup" : 0, "maxsub" : "3", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1622469890, "startdate" : "21 May 31 19:34", "child_nodes" : [], "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 16943, "max_email_per_hour" : "25", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "20", "uid" : "1234", "maxsql" : "2", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_1000 MB Linux", "user" : "perceptionpublis", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "785M", "suspendreason" : "not suspended", "domain" : "perceptionpublishing.in", "ip" : "51.91.152.238" }, { "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "saakaarbysarika.com", "diskused" : "701M", "suspendreason" : "not suspended", "theme" : "jupiter", "maxsql" : "5", "uid" : "1432", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "3", "plan" : "thesunda_cine1024", "user" : "sarikaji", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "thesunda", "max_email_per_hour" : "25", "inodesused" : 28989, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "disklimit" : "1024M", "has_backup" : 0, "email" : "sacretcode@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "0", "unix_startdate" : 1727338694, "child_nodes" : [], "startdate" : "24 Sep 26 13:48" }, { "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2500", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "vishwaroop", "plan" : "winggolearning_raj", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "941M", "ip" : "51.254.16.113", "domain" : "vishwarooppratishthan.in", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "24 Dec 07 11:01", "unix_startdate" : 1733549502, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 36982 }, { "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "10", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1006", "maxsql" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 1, "user" : "byroomsi", "plan" : "Red12Backup", "maxaddons" : "0", "maxparked" : "unlimited", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "10M", "domain" : "byrooms.in", "ip" : "51.91.152.238", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "amitsharma9170@gmail.com", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "startdate" : "20 Mar 15 09:51", "child_nodes" : [], "unix_startdate" : 1584246103, "owner" : "root", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 586, "max_email_per_hour" : "100" }, { "backup" : 1, "outgoing_mail_suspended" : 1, "user" : "digita41", "plan" : "RED14HOSTING", "ipv6" : [], "max_defer_fail_percentage" : "1", "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "1532", "maxsql" : "unlimited", "suspendreason" : "Overdue on Payment", "diskused" : "2248M", "ip" : "51.91.152.238", "domain" : "digitalvisionsolution.com", "maxaddons" : "unlimited", "maxparked" : "unlimited", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "child_nodes" : [], "startdate" : "23 Nov 29 22:46", "unix_startdate" : 1701278219, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "weblifo249@gmail.com", "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 25882, "owner" : "root", "suspendtime" : 1766989828 }, { "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "45M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "drrkpatelcollege.co.in", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "1143", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "drrkpatelcollege", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 2192, "disklimit" : "500M", "has_backup" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "unix_startdate" : 1670774161, "child_nodes" : [], "startdate" : "22 Dec 11 21:26" }, { "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 1417, "owner" : "hhtechsolution", "suspendtime" : 0, "startdate" : "24 Jul 11 12:42", "child_nodes" : [], "unix_startdate" : 1720681953, "has_backup" : 0, "disklimit" : "1500M", "maxlst" : "1", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "suspendreason" : "not suspended", "diskused" : "278M", "ip" : "51.91.152.238", "domain" : "sunshinetheyogazone.com", "maxaddons" : "0", "maxparked" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "sunshinetheyogaz", "plan" : "hhtechsolution_H_Adv", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "10", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "2669", "maxsql" : "1" }, { "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "shiv2144@gmail.com", "partition" : "home2", "has_backup" : 0, "disklimit" : "1024M", "startdate" : "25 Jul 24 20:05", "child_nodes" : [], "unix_startdate" : 1753367722, "suspendtime" : 0, "owner" : "apkquest", "inodesused" : 15453, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1975", "theme" : "jupiter", "legacy_backup" : 0, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "user" : "justev", "plan" : "apkquest_1gb", "outgoing_mail_suspended" : 0, "backup" : 1, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "justev.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "294M" }, { "user" : "sskhann2", "plan" : "apkquest_250mb", "outgoing_mail_suspended" : 0, "backup" : 1, "max_emailacct_quota" : "unlimited", "maxftp" : "5", "uid" : "1383", "maxsql" : "10", "theme" : "jupiter", "maxpop" : "15", "legacy_backup" : 1, "max_defer_fail_percentage" : "10", "ipv6" : [], "domain" : "sskhannagirlsdc-bed.com", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "276M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "child_nodes" : [], "startdate" : "24 Oct 03 11:23", "unix_startdate" : 1727934829, "maxsub" : "10", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "5", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "shiv2144@gmail.com", "disklimit" : "250M", "has_backup" : 0, "inodesused" : 9, "max_email_per_hour" : "50", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "apkquest" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 66932, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1775110344, "startdate" : "26 Apr 02 11:42", "child_nodes" : [], "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "1275M", "suspendreason" : "not suspended", "domain" : "kalkivikaskalyanfoundation.in", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "winggolearning_raj", "user" : "kalkivikaskalyan", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "uid" : "2833", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 7629, "max_email_per_hour" : "25", "owner" : "topweblogic", "suspendtime" : 0, "unix_startdate" : 1735199294, "child_nodes" : [], "startdate" : "24 Dec 26 13:18", "partition" : "home2", "email" : "topweblogic@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "25", "disklimit" : "1500M", "has_backup" : 0, "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "diskused" : "1501M", "suspendreason" : "not suspended", "domain" : "princedigitech.com", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "topweblogic_Silver Package", "user" : "princedigitech", "maxpop" : "10", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxsql" : "2", "uid" : "2158", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter" }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "startdate" : "22 Sep 27 15:26", "child_nodes" : [], "unix_startdate" : 1664272577, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 2031, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "uid" : "1215", "maxsql" : "1", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "user" : "mlmpharmacycolle", "plan" : "websbook_linux_500mb", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "ip" : "51.91.152.238", "domain" : "mlmpharmacycollege.org.in", "suspendreason" : "not suspended", "diskused" : "36M" }, { "unix_startdate" : 1636961058, "startdate" : "21 Nov 15 12:54", "child_nodes" : [], "has_backup" : 0, "disklimit" : "1000M", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "topweblogic@gmail.com", "maxlst" : "25", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "1", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 3916, "owner" : "topweblogic", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "topweblogic_Silver Package", "user" : "kamlesh", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "10", "theme" : "jupiter", "maxsql" : "2", "uid" : "2103", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "diskused" : "82M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "cosmocelular.com", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "plan" : "royaldiagnosticc_Unlimited plan", "user" : "publiccarelab", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1491", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "ip" : "51.91.152.238", "domain" : "publiccarelab.in", "diskused" : "133M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "0", "unix_startdate" : 1704816589, "startdate" : "24 Jan 09 21:39", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "unlimited", "max_email_per_hour" : "unlimited", "inodesused" : 11290, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "royaldiagnosticc" }, { "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "afsaldigimarketing@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1698293481, "child_nodes" : [], "startdate" : "23 Oct 26 09:41", "owner" : "linqindo", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 712, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1443", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "linqindo_Premium", "user" : "albareequae", "maxaddons" : "0", "maxparked" : "unlimited", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "273M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "albareequae.com" }, { "legacy_backup" : 1, "maxpop" : "10", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxsql" : "2", "uid" : "1202", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_2000mb", "user" : "lokparlok", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "2046M", "suspendreason" : "not suspended", "domain" : "lokparlok.in", "ip" : "51.91.152.238", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "maxlst" : "10", "has_backup" : 0, "disklimit" : "2000M", "maxsub" : "10", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1522933686, "startdate" : "18 Apr 05 18:38", "child_nodes" : [], "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 6, "max_email_per_hour" : "25" }, { "max_email_per_hour" : "unlimited", "inodesused" : 771, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "startdate" : "18 Apr 08 11:20", "child_nodes" : [], "unix_startdate" : 1523166618, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "has_backup" : 0, "disklimit" : "200M", "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "ip" : "51.91.152.238", "domain" : "abhayrajyadavgroup.org", "suspendreason" : "not suspended", "diskused" : "23M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "abhayrajyadavgro", "plan" : "websbook_Linux_100mb", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1085", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "5", "legacy_backup" : 1 }, { "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2557", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "neelsaraswatiash", "plan" : "winggolearning_raj", "maxparked" : "1", "maxaddons" : "1", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1013M", "domain" : "neelsaraswatiashram.in", "ip" : "51.254.16.113", "maxlst" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "25 Nov 07 12:06", "unix_startdate" : 1762497366, "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 42279, "max_email_per_hour" : "25" }, { "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "topweblogic@gmail.com", "maxlst" : "25", "has_backup" : 0, "disklimit" : "2000M", "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1741679118, "child_nodes" : [], "startdate" : "25 Mar 11 13:15", "owner" : "topweblogic", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 34843, "max_email_per_hour" : "25", "maxpop" : "10", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "uid" : "2140", "maxsql" : "5", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "topweblogic_Gold Package", "user" : "shreeshivoham", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "245M", "suspendreason" : "not suspended", "domain" : "shreeshivoham.org", "ip" : "51.91.152.238" }, { "plan" : "10gb", "user" : "site1chennaiwebs", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1301", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxpop" : "unlimited", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "site1.chennaiwebstores.com", "diskused" : "1538M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "unix_startdate" : 1602651134, "child_nodes" : [], "startdate" : "20 Oct 14 10:22", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "unlimited", "max_email_per_hour" : "unlimited", "inodesused" : 27497, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "livechen" }, { "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "871M", "domain" : "dazzlefoundation.com", "ip" : "51.254.16.113", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2228", "maxsql" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "dazzle", "plan" : "winggolearning_raj", "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 37426, "max_email_per_hour" : "25", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Dec 14 20:00", "unix_startdate" : 1734186628 }, { "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 8003, "max_email_per_hour" : "25", "maxlst" : "10", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "2000M", "maxsub" : "10", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "19 Nov 01 10:41", "unix_startdate" : 1572585067, "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "1311M", "domain" : "ramratipatelmahavidyalaya.org", "ip" : "51.91.152.238", "maxpop" : "10", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1251", "maxsql" : "2", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "ramratipatelmaha", "plan" : "websbook_linux_2000mb" }, { "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "unix_startdate" : 1738675346, "startdate" : "25 Feb 04 18:52", "child_nodes" : [], "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 19025, "mailbox_format" : "maildir", "shell" : "/bin/bash", "theme" : "jupiter", "uid" : "2274", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "plan" : "winggolearning_raj", "user" : "holipartylucknow", "outgoing_mail_suspended" : 0, "backup" : 1, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "holipartyinlucknow.in", "diskused" : "503M", "suspendreason" : "not suspended" }, { "inodesused" : 13737, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "hhtechsolution", "unix_startdate" : 1626078985, "startdate" : "21 Jul 12 14:06", "child_nodes" : [], "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "disklimit" : "250M", "has_backup" : 0, "domain" : "sbptravels.in", "ip" : "51.91.152.238", "diskused" : "201M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "plan" : "hhtechsolution_H_Basic", "user" : "sbptravels", "backup" : 1, "outgoing_mail_suspended" : 0, "uid" : "2657", "maxsql" : "1", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "ipv6" : [], "max_defer_fail_percentage" : "30" }, { "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1683990946, "child_nodes" : [], "startdate" : "23 May 13 20:45", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 221682, "max_email_per_hour" : "25", "maxpop" : "30", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxsql" : "15", "uid" : "1124", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_Unlimited Linux", "user" : "colleictcomputer", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "3432M", "suspendreason" : "not suspended", "domain" : "mpslawcollege.site", "ip" : "51.91.152.238" }, { "child_nodes" : [], "startdate" : "14 Mar 01 00:24", "unix_startdate" : 1393613684, "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "200M", "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 1315, "max_email_per_hour" : "unlimited", "owner" : "websbook", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "abhaybed", "plan" : "websbook_Linux_100mb", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "1083", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "105M", "domain" : "abhaybalikamahavidyalaya.org.in", "ip" : "51.91.152.238", "maxparked" : "0", "maxaddons" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0 }, { "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 1034, "disklimit" : "200M", "has_backup" : 0, "maxlst" : "0", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "5", "child_nodes" : [], "startdate" : "13 Nov 02 11:08", "unix_startdate" : 1383370701, "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "36M", "ip" : "51.91.152.238", "domain" : "rashtriyamahavidyalaya.org.in", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "uid" : "1252", "maxsql" : "1", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "rashtrim", "plan" : "websbook_Linux_100mb" }, { "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 44935, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1749735004, "startdate" : "25 Jun 12 19:00", "child_nodes" : [], "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "konvero.org", "diskused" : "928M", "suspendreason" : "not suspended", "theme" : "jupiter", "uid" : "2311", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "winggolearning_raj", "user" : "konvero", "backup" : 1, "outgoing_mail_suspended" : 0 }, { "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "iietrafi", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "2707", "suspendreason" : "not suspended", "diskused" : "1158M", "ip" : "51.254.16.113", "domain" : "iietrafi.org", "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "child_nodes" : [], "startdate" : "25 Dec 18 13:53", "unix_startdate" : 1766046214, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 62445, "owner" : "winggolearning", "suspendtime" : 0 }, { "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "startdate" : "22 Jun 06 11:19", "child_nodes" : [], "unix_startdate" : 1654494599, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 1472, "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 1, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1101", "maxsql" : "1", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "baijnathintercol", "plan" : "websbook_linux_500mb", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "37M", "ip" : "51.91.152.238", "domain" : "baijnathintercollege.org.in" }, { "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "omshivashivpvtit", "plan" : "websbook_linux_500mb", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [], "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "1225", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "42M", "domain" : "omshivashivpvtiti.org.in", "ip" : "51.91.152.238", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "startdate" : "20 Jul 11 15:01", "child_nodes" : [], "unix_startdate" : 1594459915, "maxlst" : "0", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "has_backup" : 0, "disklimit" : "500M", "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 939, "max_email_per_hour" : "25", "owner" : "websbook", "suspendtime" : 0 }, { "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "maxsql" : "1", "uid" : "1218", "ipv6" : [], "max_defer_fail_percentage" : "20", "legacy_backup" : 1, "maxpop" : "5", "user" : "mpslawco", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "mpslawcollege.org", "suspendreason" : "not suspended", "diskused" : "480M", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "disklimit" : "500M", "has_backup" : 0, "maxlst" : "0", "partition" : "home", "outgoing_mail_hold" : 0, "email" : "*unknown*", "child_nodes" : [], "startdate" : "13 Mar 01 14:22", "unix_startdate" : 1362127949, "suspendtime" : 0, "owner" : "websbook", "max_email_per_hour" : "25", "inodesused" : 2332, "shell" : "/bin/bash", "mailbox_format" : "maildir" }, { "user" : "braews", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2796", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "ip" : "51.254.16.113", "domain" : "braews.in", "suspendreason" : "not suspended", "diskused" : "1248M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "1", "child_nodes" : [], "startdate" : "26 Feb 27 18:38", "unix_startdate" : 1772197705, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "max_email_per_hour" : "25", "inodesused" : 67767, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "winggolearning" }, { "diskused" : "300M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "panchkhabar.com", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "default", "user" : "panchkhabarcom", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1551", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 12825, "owner" : "niipmcom", "suspendtime" : 0, "unix_startdate" : 1748419762, "child_nodes" : [], "startdate" : "25 May 28 13:39", "disklimit" : "unlimited", "has_backup" : 0, "email" : "info.panchkhabar@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited" }, { "plan" : "thesunda_cine1024_ltlfilms", "user" : "ltlfilms", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "uid" : "1418", "maxsql" : "2", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "4", "legacy_backup" : 1, "ip" : "51.91.152.238", "domain" : "ltlfilms.com", "diskused" : "675M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "unix_startdate" : 1636651759, "child_nodes" : [], "startdate" : "21 Nov 11 22:59", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "1024M", "outgoing_mail_hold" : 0, "email" : "sacretcode@gmail.com", "partition" : "home2", "maxlst" : "0", "max_email_per_hour" : "10", "inodesused" : 23707, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "thesunda" }, { "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "1", "has_backup" : 0, "disklimit" : "250M", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "nawaz7578@gmail.com", "child_nodes" : [], "startdate" : "23 Mar 31 14:27", "unix_startdate" : 1680253038, "suspendtime" : 0, "owner" : "hhtechsolution", "max_email_per_hour" : "25", "inodesused" : 327, "shell" : "/bin/bash", "mailbox_format" : "maildir", "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2642", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "5", "legacy_backup" : 1, "user" : "rabhasamproducts", "plan" : "hhtechsolution_H_Basic", "outgoing_mail_suspended" : 0, "backup" : 1, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "ip" : "51.91.152.238", "domain" : "rabhasamproductspvtltd.com", "suspendreason" : "not suspended", "diskused" : "16M" }, { "maxsub" : "5", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "1", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "has_backup" : 0, "disklimit" : "1500M", "child_nodes" : [], "startdate" : "21 Nov 24 16:04", "unix_startdate" : 1637750074, "suspendtime" : 0, "owner" : "hhtechsolution", "inodesused" : 3674, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "2651", "maxsql" : "1", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "10", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "user" : "safegatipackers", "plan" : "hhtechsolution_H_Adv", "backup" : 1, "outgoing_mail_suspended" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "domain" : "safegatipackers.org", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "1163M" }, { "domain" : "herbal-luckydrew2024.com", "ip" : "51.91.152.238", "suspendreason" : "Overdue on Payment", "diskused" : "286M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "herballu", "plan" : "Red91Solid", "backup" : 1, "outgoing_mail_suspended" : 1, "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "1536", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "inodesused" : 2111, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 1751424271, "owner" : "root", "startdate" : "24 Jul 01 12:21", "child_nodes" : [], "unix_startdate" : 1719816693, "maxsub" : "unlimited", "suspended" : 1, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "arshipatwar87@gmail.com", "disklimit" : "10000M", "has_backup" : 0 }, { "maxaddons" : "1", "maxparked" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "918M", "ip" : "51.254.16.113", "domain" : "lifelightedu.org", "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2582", "maxsql" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "lifelightedu", "plan" : "winggolearning_raj", "owner" : "winggolearning", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 42765, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "25 Dec 04 19:52", "unix_startdate" : 1764858152 }, { "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "1064", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "default", "user" : "iyawoassociation", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "1490M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "iyawoassociation.org", "has_backup" : 0, "disklimit" : "unlimited", "email" : "togolais2008@gmail.com", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1730109918, "startdate" : "24 Oct 28 15:35", "child_nodes" : [], "owner" : "otiyahos", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "*unknown*", "inodesused" : 18494 }, { "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "22M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "kbspiti.org.in", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "uid" : "1190", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500mb", "user" : "kbspitiorg", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 607, "has_backup" : 0, "disklimit" : "500M", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "unix_startdate" : 1583919945, "child_nodes" : [], "startdate" : "20 Mar 11 15:15" }, { "plan" : "winggolearning_raj", "user" : "taranewsnetwork", "outgoing_mail_suspended" : 0, "backup" : 1, "maxsql" : "unlimited", "uid" : "2865", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "30", "ipv6" : [], "domain" : "taranewsnetwork.in", "ip" : "51.254.16.113", "diskused" : "251M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "unix_startdate" : 1777017896, "startdate" : "26 Apr 24 13:34", "child_nodes" : [], "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "inodesused" : 10306, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning" }, { "domain" : "a2zenterprises.net", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "151M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "a2zenterprises", "plan" : "hhtechsolution_H_Basic", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2586", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "inodesused" : 1274, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "hhtechsolution", "startdate" : "24 Feb 15 21:43", "child_nodes" : [], "unix_startdate" : 1708013629, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "nawaz7578@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "250M", "has_backup" : 0 }, { "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "maxlst" : "0", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "3", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1378032067, "child_nodes" : [], "startdate" : "13 Sep 01 16:11", "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 2274, "max_email_per_hour" : "25", "legacy_backup" : 1, "maxpop" : "3", "ipv6" : [], "max_defer_fail_percentage" : "20", "maxsql" : "2", "uid" : "1237", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500 mb_second", "user" : "pms4bnpa", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "129M", "suspendreason" : "not suspended", "domain" : "pms4bnpac.com", "ip" : "51.91.152.238" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 36508, "owner" : "winggolearning", "suspendtime" : 0, "unix_startdate" : 1736159583, "child_nodes" : [], "startdate" : "25 Jan 06 16:03", "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "diskused" : "907M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "asthashree.in", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "asthashree", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2188", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited" }, { "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1763812210, "child_nodes" : [], "startdate" : "25 Nov 22 17:20", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 42325, "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 0, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2573", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "ramsewatrust", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "969M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "shreeramsewatrust.in" }, { "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "179M", "suspendreason" : "not suspended", "domain" : "gcafc.in", "ip" : "51.91.152.238", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "1", "uid" : "2611", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "hhtechsolution_H_Basic", "user" : "gcafc", "owner" : "hhtechsolution", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 843, "max_email_per_hour" : "25", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "nawaz7578@gmail.com", "maxlst" : "unlimited", "disklimit" : "250M", "has_backup" : 0, "maxsub" : "1", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1686671247, "startdate" : "23 Jun 13 21:17", "child_nodes" : [] }, { "startdate" : "21 Mar 17 22:50", "child_nodes" : [], "unix_startdate" : 1616001624, "has_backup" : 0, "disklimit" : "10000M", "maxlst" : "10", "outgoing_mail_hold" : 0, "partition" : "home", "email" : "*unknown*", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "10", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 10228, "owner" : "websiteg", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "annaigroup", "plan" : "websiteg_Pack1", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "10", "theme" : "jupiter", "maxftp" : "10", "max_emailacct_quota" : "unlimited", "uid" : "1081", "maxsql" : "10", "suspendreason" : "not suspended", "diskused" : "1011M", "ip" : "51.91.152.238", "domain" : "annai.group", "maxparked" : "10", "maxaddons" : "10", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0 }, { "owner" : "royaldiagnosticc", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 23469, "max_email_per_hour" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "*unknown*", "has_backup" : 0, "disklimit" : "unlimited", "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "24 Aug 04 12:11", "unix_startdate" : 1722753702, "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "290M", "domain" : "parentsdiag.in", "ip" : "51.91.152.238", "maxpop" : "unlimited", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1488", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "parentsdiag", "plan" : "royaldiagnosticc_Unlimited" }, { "inodesused" : 31631, "max_email_per_hour" : "25", "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "winggolearning", "unix_startdate" : 1721971133, "child_nodes" : [], "startdate" : "24 Jul 26 10:48", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "domain" : "sarthiglobalfoundation.in", "ip" : "51.254.16.113", "diskused" : "1007M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "1", "maxaddons" : "1", "plan" : "winggolearning_raj", "user" : "sarthiglobal", "outgoing_mail_suspended" : 0, "backup" : 1, "uid" : "2422", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [] }, { "owner" : "root", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 27654, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "partition" : "home2", "email" : "sacretcode@gmail.com", "outgoing_mail_hold" : 0, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "child_nodes" : [], "startdate" : "20 Jan 23 16:51", "unix_startdate" : 1579778506, "maxaddons" : "0", "maxparked" : "unlimited", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "3413M", "ip" : "51.91.152.238", "domain" : "thesundayheadlines.com", "max_defer_fail_percentage" : "100", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1389", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "thesunda", "plan" : "RED31RESELLER" }, { "max_defer_fail_percentage" : "30", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "unlimited", "theme" : "jupiter", "uid" : "2237", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "divineheart", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "1851M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "divineheartfoundationindia.org", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1732024758, "child_nodes" : [], "startdate" : "24 Nov 19 19:29", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 47721 }, { "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1859, "max_email_per_hour" : "25", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1490249882, "child_nodes" : [], "startdate" : "17 Mar 23 11:48", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "101M", "suspendreason" : "not suspended", "domain" : "psmabvs.org", "ip" : "51.91.152.238", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxsql" : "1", "uid" : "1243", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "websbook_linux_500mb", "user" : "psmabvs" }, { "maxpop" : "5", "legacy_backup" : 0, "max_defer_fail_percentage" : "20", "ipv6" : [], "maxsql" : "1", "uid" : "1597", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_linux_500mb", "user" : "gussamitiorg", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "26M", "suspendreason" : "not suspended", "domain" : "gussamiti.org.in", "ip" : "51.91.152.238", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "0", "disklimit" : "500M", "has_backup" : 0, "maxsub" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1749638476, "startdate" : "25 Jun 11 16:11", "child_nodes" : [], "owner" : "websbook", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 1058, "max_email_per_hour" : "25" }, { "child_nodes" : [], "startdate" : "24 Nov 29 17:26", "unix_startdate" : 1732881379, "has_backup" : 0, "disklimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 35767, "owner" : "winggolearning", "suspendtime" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "dhairyaprayaswf", "plan" : "winggolearning_raj", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2233", "maxsql" : "unlimited", "suspendreason" : "not suspended", "diskused" : "895M", "ip" : "51.254.16.113", "domain" : "dhairyaprayaswf.in", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0 }, { "startdate" : "24 Sep 03 03:27", "child_nodes" : [], "unix_startdate" : 1725314261, "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "1024M", "has_backup" : 0, "maxlst" : "unlimited", "email" : "sanjeev@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "max_email_per_hour" : "25", "inodesused" : 12729, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "apkquest", "user" : "adbhut", "plan" : "apkquest_1gb", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1349", "maxsql" : "unlimited", "ipv6" : [], "max_defer_fail_percentage" : "unlimited", "legacy_backup" : 1, "maxpop" : "unlimited", "ip" : "51.91.152.238", "domain" : "adbhut.org", "suspendreason" : "not suspended", "diskused" : "223M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0" }, { "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1245", "maxsql" : "2", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "publicnoblesch", "plan" : "websbook_1000 MB Linux", "maxaddons" : "0", "maxparked" : "0", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "51M", "domain" : "noblepublicschool.org.in", "ip" : "51.91.152.238", "maxlst" : "1", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "disklimit" : "1000M", "has_backup" : 0, "maxsub" : "3", "suspended" : 0, "inodeslimit" : "unlimited", "child_nodes" : [], "startdate" : "25 May 01 00:24", "unix_startdate" : 1746039287, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 1242, "max_email_per_hour" : "25" }, { "maxpop" : "unlimited", "legacy_backup" : 0, "ipv6" : [], "max_defer_fail_percentage" : "30", "maxsql" : "unlimited", "uid" : "2708", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "marwadyuvavikass", "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "847M", "suspendreason" : "not suspended", "domain" : "marwadyuvavikassansthan.in", "ip" : "51.254.16.113", "outgoing_mail_hold" : 0, "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1766125401, "child_nodes" : [], "startdate" : "25 Dec 19 11:53", "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 58316, "max_email_per_hour" : "25" }, { "diskused" : "7M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "drscollegemirzapur.org.in", "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "websbook_Linux_100mb", "user" : "drscollegemirzap", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "theme" : "jupiter", "uid" : "1144", "maxsql" : "1", "max_emailacct_quota" : "unlimited", "maxftp" : "0", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "unlimited", "inodesused" : 377, "owner" : "websbook", "suspendtime" : 0, "unix_startdate" : 1498382751, "startdate" : "17 Jun 25 14:55", "child_nodes" : [], "disklimit" : "200M", "has_backup" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "5" }, { "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2321", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "maajagadamba", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "diskused" : "1003M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "maajagadambathakuranitrust.org", "has_backup" : 0, "disklimit" : "unlimited", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1750233918, "startdate" : "25 Jun 18 13:35", "child_nodes" : [], "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 46540 }, { "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "unix_startdate" : 1734956940, "startdate" : "24 Dec 23 17:59", "child_nodes" : [], "suspendtime" : 0, "owner" : "winggolearning", "max_email_per_hour" : "25", "inodesused" : 37724, "mailbox_format" : "maildir", "shell" : "/bin/bash", "theme" : "jupiter", "maxsql" : "unlimited", "uid" : "2417", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "max_defer_fail_percentage" : "30", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "plan" : "winggolearning_raj", "user" : "sankranti", "backup" : 1, "outgoing_mail_suspended" : 0, "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "1", "maxparked" : "1", "ip" : "51.254.16.113", "domain" : "sankrantibhavishyafoundation.com", "diskused" : "895M", "suspendreason" : "not suspended" }, { "max_email_per_hour" : "25", "inodesused" : 5020, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1494341089, "startdate" : "17 May 09 20:14", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "3", "disklimit" : "1000M", "has_backup" : 0, "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "maxlst" : "1", "ip" : "51.91.152.238", "domain" : "duplexbitcoin.com", "diskused" : "51M", "suspendreason" : "not suspended", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxaddons" : "0", "maxparked" : "0", "plan" : "websbook_1000 MB Linux", "user" : "duplexbitcoin", "outgoing_mail_suspended" : 0, "backup" : 1, "theme" : "jupiter", "maxsql" : "2", "uid" : "1147", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "max_defer_fail_percentage" : "20", "ipv6" : [], "maxpop" : "5", "legacy_backup" : 1 }, { "suspendtime" : 0, "owner" : "root", "inodesused" : 102, "max_email_per_hour" : "unlimited", "mailbox_format" : "mdbox", "shell" : "/bin/bash", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "partition" : "home", "email" : "username@example.com", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "unlimited", "unix_startdate" : 1709368818, "startdate" : "24 Mar 02 14:10", "child_nodes" : [], "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxaddons" : "unlimited", "maxparked" : "0", "domain" : "aaaaaaaa.info", "ip" : "51.91.152.238", "diskused" : "2M", "suspendreason" : "not suspended", "uid" : "1051", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 0, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "default", "user" : "aaaaaaaa", "outgoing_mail_suspended" : 0, "backup" : 1 }, { "suspendreason" : "not suspended", "diskused" : "300M", "ip" : "51.91.152.238", "domain" : "holymissiondhaka.co.in", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "hmpsdhaka", "plan" : "default", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "maxsql" : "unlimited", "uid" : "1072", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "unlimited", "inodesused" : 11676, "owner" : "niipmcom", "suspendtime" : 0, "child_nodes" : [], "startdate" : "25 Mar 02 12:36", "unix_startdate" : 1740899209, "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "*unknown*", "partition" : "home", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "unlimited" }, { "inodesused" : 1367, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "websbook", "startdate" : "23 Jun 10 00:01", "child_nodes" : [], "unix_startdate" : 1686335462, "maxsub" : "0", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "0", "partition" : "home", "email" : "*unknown*", "outgoing_mail_hold" : 0, "disklimit" : "500M", "has_backup" : 0, "domain" : "mvwswrds.org.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "35M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "0", "maxaddons" : "0", "user" : "mvwswrdsorg", "plan" : "websbook_linux_500mb", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "1", "max_emailacct_quota" : "unlimited", "uid" : "1222", "maxsql" : "1", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "ipv6" : [], "max_defer_fail_percentage" : "20" }, { "inodesused" : 3486, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 0, "owner" : "hhtechsolution", "child_nodes" : [], "startdate" : "23 Dec 31 16:54", "unix_startdate" : 1704021883, "maxsub" : "1", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "nawaz7578@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "has_backup" : 0, "disklimit" : "250M", "domain" : "dlogistics.co.in", "ip" : "51.91.152.238", "suspendreason" : "not suspended", "diskused" : "109M", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "user" : "dlogisticsco", "plan" : "hhtechsolution_H_Basic", "backup" : 1, "outgoing_mail_suspended" : 0, "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2604", "theme" : "jupiter", "maxpop" : "5", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [] }, { "user" : "pursekey", "plan" : "RED92SSD", "backup" : 1, "outgoing_mail_suspended" : 1, "theme" : "jupiter", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "maxsql" : "unlimited", "uid" : "2712", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxpop" : "unlimited", "legacy_backup" : 0, "ip" : "51.91.152.238", "domain" : "pursekey.pro", "suspendreason" : "Overdue on Payment", "diskused" : "2172M", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "maxaddons" : "1", "maxparked" : "unlimited", "child_nodes" : [], "startdate" : "25 Dec 22 11:46", "unix_startdate" : 1766384183, "suspended" : 1, "inodeslimit" : "unlimited", "maxsub" : "unlimited", "disklimit" : "unlimited", "has_backup" : 0, "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "paulaz222111@gmail.com", "partition" : "home2", "max_email_per_hour" : "25", "inodesused" : 117759, "shell" : "/bin/bash", "mailbox_format" : "maildir", "suspendtime" : 1768977034, "owner" : "root" }, { "maxaddons" : "0", "maxparked" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "3423M", "suspendreason" : "not suspended", "domain" : "riyawebsolutions.com", "ip" : "51.91.152.238", "legacy_backup" : 1, "maxpop" : "unlimited", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "maxsql" : "unlimited", "uid" : "1517", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "theme" : "jupiter", "outgoing_mail_suspended" : 0, "backup" : 1, "plan" : "Red91Solid", "user" : "riyawebs", "owner" : "root", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "inodesused" : 120268, "max_email_per_hour" : "unlimited", "email" : "raomsyg@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "maxlst" : "unlimited", "has_backup" : 0, "disklimit" : "10000M", "maxsub" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "unix_startdate" : 1714906277, "child_nodes" : [], "startdate" : "24 May 05 16:21" }, { "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "*unknown*", "inodesused" : 50193, "owner" : "topweblogic", "suspendtime" : 0, "unix_startdate" : 1563367351, "startdate" : "19 Jul 17 18:12", "child_nodes" : [], "disklimit" : "unlimited", "has_backup" : 0, "email" : "topweblogic@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "diskused" : "5556M", "suspendreason" : "not suspended", "ip" : "51.91.152.238", "domain" : "acdcpowercare.com", "maxparked" : "0", "maxaddons" : "0", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "default", "user" : "acdcpowercare", "ipv6" : [], "max_defer_fail_percentage" : "*unknown*", "maxpop" : "unlimited", "legacy_backup" : 1, "theme" : "jupiter", "uid" : "2102", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited" }, { "child_nodes" : [], "startdate" : "25 Sep 29 11:12", "unix_startdate" : 1759124552, "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "inodesused" : 69518, "max_email_per_hour" : "25", "owner" : "winggolearning", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "user" : "pjjankalyanfound", "plan" : "winggolearning_raj", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "uid" : "2375", "maxsql" : "unlimited", "theme" : "jupiter", "suspendreason" : "not suspended", "diskused" : "874M", "domain" : "pjjankalyanfoundation.org", "ip" : "51.254.16.113", "maxparked" : "1", "maxaddons" : "1", "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0 }, { "owner" : "winggolearning", "suspendtime" : 0, "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 44631, "has_backup" : 0, "disklimit" : "unlimited", "partition" : "home2", "outgoing_mail_hold" : 0, "email" : "mourya.rajkumar25@gmail.com", "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "unix_startdate" : 1765626067, "startdate" : "25 Dec 13 17:11", "child_nodes" : [], "maxparked" : "1", "maxaddons" : "1", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "diskused" : "919M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "pdduy.in", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "uid" : "2706", "maxsql" : "unlimited", "maxftp" : "unlimited", "max_emailacct_quota" : "unlimited", "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "pdduy" }, { "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "maxparked" : "0", "maxaddons" : "0", "domain" : "shribalramsinghmahavidyalaya.org", "ip" : "51.91.152.238", "diskused" : "26M", "suspendreason" : "not suspended", "maxsql" : "1", "uid" : "1288", "maxftp" : "0", "max_emailacct_quota" : "unlimited", "theme" : "jupiter", "legacy_backup" : 1, "maxpop" : "5", "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "plan" : "websbook_Linux_100mb", "user" : "shribalr", "outgoing_mail_suspended" : 0, "backup" : 1, "suspendtime" : 0, "owner" : "websbook", "inodesused" : 983, "max_email_per_hour" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "maxsub" : "5", "inodeslimit" : "unlimited", "suspended" : 0, "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home", "maxlst" : "0", "has_backup" : 0, "disklimit" : "200M", "unix_startdate" : 1362127455, "startdate" : "13 Mar 01 14:14", "child_nodes" : [] }, { "maxsub" : "unlimited", "suspended" : 0, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "email" : "mourya.rajkumar25@gmail.com", "outgoing_mail_hold" : 0, "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "child_nodes" : [], "startdate" : "24 Jul 02 15:49", "unix_startdate" : 1719915540, "suspendtime" : 0, "owner" : "winggolearning", "inodesused" : 144474, "max_email_per_hour" : "25", "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "2446", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "30", "ipv6" : [], "user" : "shreeshyamrasoi", "plan" : "winggolearning_raj", "backup" : 1, "outgoing_mail_suspended" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxparked" : "1", "maxaddons" : "1", "domain" : "shreeshyamrasoi.in", "ip" : "51.254.16.113", "suspendreason" : "not suspended", "diskused" : "1907M" }, { "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "is_locked" : 0, "maxaddons" : "0", "maxparked" : "0", "domain" : "sasiusa.org", "ip" : "51.91.152.238", "suspendreason" : "Unknown", "diskused" : "158M", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "uid" : "1525", "maxsql" : "unlimited", "theme" : "jupiter", "maxpop" : "unlimited", "legacy_backup" : 1, "max_defer_fail_percentage" : "unlimited", "ipv6" : [], "user" : "sasiusa", "plan" : "default", "outgoing_mail_suspended" : 1, "backup" : 1, "suspendtime" : 1767125997, "owner" : "pawsnmei", "inodesused" : 6914, "max_email_per_hour" : "unlimited", "shell" : "/bin/bash", "mailbox_format" : "maildir", "maxsub" : "unlimited", "suspended" : 1, "inodeslimit" : "unlimited", "maxlst" : "unlimited", "outgoing_mail_hold" : 0, "email" : "onedestinyahead@gmail.com", "partition" : "home2", "disklimit" : "unlimited", "has_backup" : 0, "child_nodes" : [], "startdate" : "24 Jul 04 15:30", "unix_startdate" : 1720087209 }, { "has_backup" : 0, "disklimit" : "500M", "maxlst" : "0", "email" : "*unknown*", "outgoing_mail_hold" : 0, "partition" : "home2", "suspended" : 0, "inodeslimit" : "unlimited", "maxsub" : "0", "child_nodes" : [], "startdate" : "26 Jan 18 11:22", "unix_startdate" : 1768715568, "owner" : "websbook", "suspendtime" : 0, "shell" : "/bin/bash", "mailbox_format" : "maildir", "max_email_per_hour" : "25", "inodesused" : 945, "ipv6" : [], "max_defer_fail_percentage" : "20", "maxpop" : "5", "legacy_backup" : 0, "theme" : "jupiter", "maxftp" : "1", "max_emailacct_quota" : "unlimited", "maxsql" : "1", "uid" : "2747", "outgoing_mail_suspended" : 0, "backup" : 1, "user" : "kartikeyasewaorg", "plan" : "websbook_linux_500mb", "maxparked" : "0", "maxaddons" : "0", "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5", "is_locked" : 0, "suspendreason" : "not suspended", "diskused" : "22M", "ip" : "51.91.152.238", "domain" : "kartikeyasewa.org.in" }, { "unix_startdate" : 1768478527, "child_nodes" : [], "startdate" : "26 Jan 15 17:32", "disklimit" : "unlimited", "has_backup" : 0, "email" : "mourya.rajkumar25@gmail.com", "partition" : "home2", "outgoing_mail_hold" : 0, "maxlst" : "unlimited", "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "unlimited", "mailbox_format" : "maildir", "shell" : "/bin/bash", "max_email_per_hour" : "25", "inodesused" : 67374, "owner" : "winggolearning", "suspendtime" : 0, "backup" : 1, "outgoing_mail_suspended" : 0, "plan" : "winggolearning_raj", "user" : "hazaribaghyw", "ipv6" : [], "max_defer_fail_percentage" : "30", "maxpop" : "unlimited", "legacy_backup" : 0, "theme" : "jupiter", "uid" : "2743", "maxsql" : "unlimited", "max_emailacct_quota" : "unlimited", "maxftp" : "unlimited", "diskused" : "1268M", "suspendreason" : "not suspended", "ip" : "51.254.16.113", "domain" : "hazaribaghyw.in", "maxaddons" : "1", "maxparked" : "1", "is_locked" : 0, "temporary" : 0, "min_defer_fail_to_trigger_protection" : "5" }, { "ip" : "51.91.152.238", "domain" : "aaspvtiti.org.in", "diskused" : "52M", "suspendreason" : "not suspended", "is_locked" : 0, "min_defer_fail_to_trigger_protection" : "5", "temporary" : 0, "maxparked" : "0", "maxaddons" : "0", "plan" : "websbook_linux_500mb", "user" : "aaspvtitiorg", "backup" : 1, "outgoing_mail_suspended" : 0, "theme" : "jupiter", "maxsql" : "1", "uid" : "1080", "max_emailacct_quota" : "unlimited", "maxftp" : "1", "max_defer_fail_percentage" : "20", "ipv6" : [], "legacy_backup" : 1, "maxpop" : "5", "max_email_per_hour" : "25", "inodesused" : 1028, "mailbox_format" : "maildir", "shell" : "/bin/bash", "suspendtime" : 0, "owner" : "websbook", "unix_startdate" : 1656136497, "startdate" : "22 Jun 25 11:24", "child_nodes" : [], "inodeslimit" : "unlimited", "suspended" : 0, "maxsub" : "0", "has_backup" : 0, "disklimit" : "500M", "email" : "*unknown*", "partition" : "home", "outgoing_mail_hold" : 0, "maxlst" : "0" } ] } }